KEGG   Chryseobacterium sp. T16E-39: CEY12_18575Help
Entry
CEY12_18575       CDS       T04952                                 

Definition
(GenBank) sugar dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
chry  Chryseobacterium sp. T16E-39
Pathway
chry00030  Pentose phosphate pathway
chry01100  Metabolic pathways
chry01120  Microbial metabolism in diverse environments
chry01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:chry00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CEY12_18575
Enzymes [BR:chry01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     CEY12_18575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase THF_DHG_CYH_C 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ASK31983
UniProt: A0A220SF45
Position
4088529..4089338
Genome map
AA seq 269 aa AA seqDB search
MEISLRNQVAVVTGASSGIGTGIAKSLASAGATIIVNHSSERSTDEAKAVLKEITDTGGS
GITYQCDVSKEDQVVAMFQDVVSQFGTVDILINNAGIQKDSKFTEMTIDQWNAVIGVNLT
GQFLCAREAIKEFLRRGIDLSRSKACGKIIHISSVHEIIPWAGHANYASSKGAIRMLMQT
LAQEHGADKIRVNSICPGAIQTPINKDAWSTPEALNSLLNLIPYNRIGQPEDIGNLAAFL
ASDLADYITGTSVFVDGGMTTFESFSTGG
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggaaatatcacttcgtaatcaggtggctgtcgttacgggagcatcaagtggaattgga
accggaatcgctaaatctcttgcctctgcaggagctacaataatagtcaaccactcttcg
gaaagatctacagatgaagcaaaggcagtcttgaaagaaattacagacaccggaggttca
gggatcacctatcaatgtgatgtttcgaaagaagatcaggtggtagccatgtttcaggat
gttgtttcgcaatttggaactgtagatatccttattaataacgcgggtatccagaaagat
tctaagtttacagaaatgactattgatcagtggaatgccgtgatcggggtcaatttaacg
ggacaatttctttgtgcccgcgaagctattaaagaatttttacgccgtggaatagatctt
tcccgatcaaaagcttgtggaaagatcatccatatcagttccgttcatgaaattattccc
tgggctggacatgcgaactacgcatccagtaaaggtgcaatcagaatgctaatgcaaaca
ttagctcaggaacatggagcagataagatccgggttaattctatttgtccgggtgcaatt
caaactcctattaataaagatgcctggagtactcctgaggcattaaacagccttcttaac
cttatcccttacaaccgaatcggacaaccggaagatatcggaaatctggcggcattttta
gcaagtgacctggctgattatattacgggaactagtgttttcgtggatggcggaatgact
actttcgagagcttttctacgggcggataa

DBGET integrated database retrieval system