KEGG   Chryseobacterium sp. 6424: CO230_02780Help
Entry
CO230_02780       CDS       T05704                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
chrz  Chryseobacterium sp. 6424
Pathway
chrz00730  Thiamine metabolism
chrz00790  Folate biosynthesis
chrz01100  Metabolic pathways
chrz02020  Two-component system
Module
chrz_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:chrz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    CO230_02780
   00790 Folate biosynthesis
    CO230_02780
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CO230_02780
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chrz04147]
    CO230_02780
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:chrz00537]
    CO230_02780
Enzymes [BR:chrz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CO230_02780
Exosome [BR:chrz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CO230_02780
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:chrz00537]
 Enzymes
  CO230_02780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Phosphodiest TAT_signal
Motif
Other DBs
NCBI-ProteinID: AYO57145
UniProt: A0A3G2TAM0
Position
complement(598465..599874)
Genome map
AA seq 469 aa AA seqDB search
MKRRDLLKSGSLALGGLLLTPFSAKANIFKEEFGGKKAKNIIFMVSDGMSIGTLQMADMY
SRRKLGRPSQWLSLYEQNLVQRGLMDMASANSVVTDSAAASSSWGGGHRVNNGSLNIGVN
GEEHLPILQKFKKAGKKIGLVTTVPVTHATPAGFSVYSKSRNSQQDIAMTYSELGFDVIM
GGGHKYFDAAQREDKKDVYSVFRKKGYSVARNKAEMNATPANKPLLATFDEDGLPYSTDH
LSSTFMKNNIPTLAEMTSKAIGHMKDDKNGFVMQVEAGKVDWAAHGNDISGLIYDQLAFD
DAVKVAIDFAKKDGNTLVVLTTDHGNANPGLIYGRKVNENFDRIQKFSQTNEWILQGING
NDSLSTIKDRIAQANAGIAITDEQAKEIQSYYAKAKMEDGMYNPRHLPFKLLSQIQQDYT
SVGWISMDHSADYSEVAMFGPGSEQMKPFMKNTDMHTFLLKAAEVENKF
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagacgcgatttattgaaaagcggttctctggccttaggcggactgcttctcaca
ccttttagtgcgaaagcgaatatatttaaagaagaatttggcggtaagaaagcgaagaat
atcatatttatggtcagcgatggcatgagcatcggcaccctgcagatggccgatatgtac
agccgccgcaaactgggacggccttcgcagtggctttctttatacgagcaaaatctggta
cagcgcggactgatggatatggcttcggccaattcggtagtgacagattcggcggcagca
agctcctcatggggtggcgggcaccgcgtgaataacggcagcctgaacataggcgtcaat
ggtgaagagcatttgcccatccttcagaaattcaaaaaagcaggcaaaaagatcggtttg
gtgaccacggttccggtgacacatgccacaccagcgggattttcggtttacagcaaaagc
cggaattctcagcaggatattgccatgacttattctgaattaggatttgatgtcatcatg
ggcggtggacataaatatttcgatgcggcgcagcgcgaagacaagaaagacgtttattca
gttttcaggaaaaaaggctattccgtggcacgcaataaggctgaaatgaatgctacacct
gctaacaaacctctccttgccacctttgatgaagatggtttgccctattctaccgatcac
ctcagcagcacttttatgaaaaacaacatcccgacgctggcagaaatgacttcaaaagcc
atcggacacatgaaggatgacaaaaacggattcgtgatgcaggttgaagccggaaaagtc
gactgggcggcgcacggaaacgatatttcaggcctcatctacgatcagctcgcgttcgat
gatgccgtgaaagtggcgattgatttcgctaaaaaagacggcaacacgctggtagtttta
acgacagaccacggcaatgccaatcccggacttatctatggccgaaaggtcaacgaaaat
ttcgaccgcatccaaaaattctcgcaaaccaacgaatggatcctgcagggaatcaacggc
aacgacagcctcagcaccatcaaagaccgtatcgcgcaggccaatgccggaatcgcgatt
accgatgagcaggccaaagaaatccaatcctattatgccaaagcaaaaatggaagacggc
atgtacaatccgcggcatcttccgttcaaattactgtctcaaattcagcaggattacacc
tcagtaggctggatcagcatggatcactcggcggactacagcgaagtggcgatgtttgga
cccggcagcgaacagatgaaaccgtttatgaaaaatacggatatgcacactttccttctg
aaggcggcggaggttgagaataagttttag

DBGET integrated database retrieval system