KEGG   Chryseobacterium sp. 6424: CO230_05735Help
Entry
CO230_05735       CDS       T05704                                 

Definition
(GenBank) succinyl-CoA--3-ketoacid-CoA transferase
  KO
K01028  3-oxoacid CoA-transferase subunit A [EC:2.8.3.5]
Organism
chrz  Chryseobacterium sp. 6424
Pathway
chrz00072  Synthesis and degradation of ketone bodies
chrz00280  Valine, leucine and isoleucine degradation
chrz00650  Butanoate metabolism
chrz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chrz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CO230_05735
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    CO230_05735
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CO230_05735
Enzymes [BR:chrz01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     CO230_05735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans
Motif
Other DBs
NCBI-ProteinID: AYO57666
UniProt: A0A3G2TC54
Position
1219458..1220159
Genome map
AA seq 233 aa AA seqDB search
MIDKRVNNAQEAIEGITDGMTLIIGGFGLCGIPENTINALVESNVSSLTCISNNAGVDDF
GLGLLLQKRQIKKMISSYVGENAEFERQMLSGELEVELTPQGTLAEKCRAAQHGIPAFYT
PAGYGTEVAEGKETKEFNGKMHILEHAFEADFSIVKAWKGDHAGNLIFKGTARNFNAPMA
GAGKITIAEVEELVAPGELDPNEIHIPGIMVQRIFQGEKFEKRIEQRTVRKRA
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacaaaagagtaaataacgcccaagaagccatcgaaggaattaccgacggcatg
acccttatcatcggcggcttcggactgtgcggtatccccgagaacaccattaatgcgctc
gtagaaagcaatgtttcatcccttacatgcatatcaaacaatgcgggagttgatgatttc
ggtttgggactgcttttacaaaaaaggcagattaaaaagatgatctcctcatacgtcggc
gaaaatgccgaattcgaaagacagatgctttccggcgaactcgaggtagaactcactcca
cagggcactttggctgaaaaatgccgcgctgcacaacatggcattcccgctttctacaca
cctgcgggctacggcaccgaagtcgctgaaggcaaggaaaccaaagagttcaacggcaaa
atgcacatcctcgaacatgcttttgaagctgatttctccatcgtaaaagcctggaaaggc
gaccacgccggaaatttaatttttaaaggcaccgcccgaaacttcaacgcgcccatggcc
ggagccggcaaaattacaattgctgaagtagaagaacttgtagcgcccggtgaacttgat
ccgaatgaaatccacattccgggaatcatggtgcagcgcatcttccagggagaaaaattc
gagaaaagaatagaacaacgcacggtccgcaaacgcgcgtag

DBGET integrated database retrieval system