KEGG   Chlamydia psittaci 01DC11: CPS0A_0971Help
Entry
CPS0A_0971        CDS       T01860                                 

Gene name
ribB
Definition
(GenBank) bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II protein
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
chs  Chlamydia psittaci 01DC11
Pathway
chs00740  Riboflavin metabolism
chs00790  Folate biosynthesis
chs01100  Metabolic pathways
chs01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:chs00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    CPS0A_0971 (ribB)
   00790 Folate biosynthesis
    CPS0A_0971 (ribB)
Enzymes [BR:chs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     CPS0A_0971 (ribB)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     CPS0A_0971 (ribB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: AEG86893
UniProt: A0A0E2IWF0
Position
complement(1034122..1035384)
Genome map
AA seq 420 aa AA seqDB search
MIKFNNDARASCFVPVEKAIADIAEGKFVIVVDETSRENEGDLIIAGEKMTVEKMTFLLK
YTTGIICAALDSERVKQLDLPPMVKDNRCRYRTAFTVSVDAAKGVTTGVSAADRTRVVEL
LSDPNSVPEDFVRPGHFFPLMATPGGVLKRAGHTEAALDLMRLANMQACGILSELVNEDH
TMMRLPQIVEFAMKHKISVISTSDLVAYRMLSERLVVPISSARLPTEYGDFNIHVYESVL
DGIQHIALVKGDVQGKENVLVRVHSECLTGDIMGSIRCDCGHQLRSAMEYIGLEGEGVIV
YLRGQEGRGIGLGHKVRAYALQDRGYDTVDANLEIGFPIDSREYGIGAQILVDLGLTKIK
LITHNPHKYYGLQGYGLEIVDRIALPINISEENECYLRTKKERMGHWIDFPSYKEEVNTR
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtgataaaattcaataatgatgctcgtgcctcttgttttgtccctgtagaaaaagctatt
gcagatattgctgagggtaaatttgttattgttgttgatgagacttcaagggagaatgag
ggagatcttatcatagcaggcgagaaaatgaccgttgaaaaaatgacttttctccttaaa
tatacgacgggaattatctgtgctgctttagattctgagagagtaaaacaattagacctc
ccccctatggttaaagataaccgttgtcgctaccgtacggcatttacagtttcggtagat
gctgctaaaggcgtaactacaggcgtgtctgcagcagatagaacaagagtagttgaactg
ctatctgaccctaatagtgttcctgaggattttgttcgtccggggcatttctttccttta
atggctacgccgggaggcgtattaaaacgagccggtcatacagaagctgctttagatctc
atgcgtttagccaatatgcaggcttgtgggatcctttcggagcttgtcaatgaagaccac
acgatgatgcgtcttccgcaaattgtagaatttgctatgaagcataaaatctcggtcata
tctacgtctgatttggtagcctaccgaatgttatccgaaaggctcgtggttcctatttct
tcagctcgtcttcctacagaatatggggattttaatattcatgtttacgagtccgtgctt
gatggcatccaacatattgctttggtgaaaggtgatgtgcaagggaaggagaatgtactt
gtgcgagtacattctgaatgccttactggtgatatcatggggtccatacgttgtgattgt
ggacaccaattgcgctctgctatggaatatattggattagagggtgaaggtgttattgtt
tatctacgcggacaagagggacgtggtattggattaggtcataaagttcgagcctacgct
ttacaagatcgtgggtatgatactgtcgatgctaacttagaaattggcttccctatagat
tctagagaatatggaatcggggctcagattttagttgatctaggattgacaaagatcaaa
ttgattacccataatccccacaaatattacggccttcagggatatgggttagaaattgtt
gatagaatagctcttcccatcaatatctctgaagaaaatgaatgttacctccgcacaaaa
aaagagcgtatgggacattggatagactttccttcttataaagaagaagtgaacacaaga
taa

DBGET integrated database retrieval system