KEGG   Chlamydia psittaci 08DC60: CPS0D_1105Help
Entry
CPS0D_1105        CDS       T01862                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
cht  Chlamydia psittaci 08DC60
Pathway
cht00780  Biotin metabolism
cht01100  Metabolic pathways
Module
cht_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:cht00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CPS0D_1105
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cht01007]
    CPS0D_1105
Enzymes [BR:cht01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     CPS0D_1105
Amino acid related enzymes [BR:cht01007]
 Aminotransferase (transaminase)
  Class II
   CPS0D_1105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AEG88795
Position
complement(969329..970435)
Genome map
AA seq 368 aa AA seqDB search
MSECPIDFVTNDFLGFSRSTVLVNEVERRYRLYCEQFPQAQLGASGSRAIAGPSQTLQKL
EAKIAKFHQAEAAFVVHSGYMANLGFCYHISKDTDMVFWDASVHVSVVQSLKMISGKHQS
FPHNDLNALESLLMSHRAVSSGRIFIFVCSVYSFLGTLAPLEELLALSRKYHAHLIVDEA
HAMGIFGEEGRGLCHKWGYENFYAVLVTYSKAMGAMGAAILSSSEVKTELMLNSPPLRYT
TALAPHALITISAAYDHLFVAGELARKQVFALQEYFQQYFGLSSQGCGQPIFLQDFNFDL
LVSLLNEANLRVGLMTFADKPFIRVNFHAFNHQDEVNLLIAVLHSYLEKCSCRIDVNHEF
YFGRQFCS
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaatgcccaatagattttgtaactaacgatttcctaggtttctctcgctctaca
gtattagtaaatgaagttgagagacgctatcgtttatattgtgaacaatttcctcaagcc
caacttggagcaagtggttctcgtgctattgcaggcccttcccaaactttacaaaaatta
gaagcaaagatagcgaaattccatcaagctgaggcggcttttgtcgtacacagcggctat
atggcgaatttaggtttctgctatcacatttctaaagataccgatatggtcttttgggat
gcgtctgtacacgtatccgttgtacaaagtttaaaaatgatatccggaaaacatcaatcg
tttcctcataatgatttaaacgctctagaatctttattaatgtctcatagagcagtctca
tcaggaagaattttcatttttgtttgttcggtatactctttcttaggaactttagctcct
cttgaagaacttttagctctttcaagaaaatatcatgctcaccttattgtagacgaagct
catgctatgggaatttttggcgaggagggccgtggattgtgtcacaaatgggggtatgag
aatttttatgctgttcttgttacctatagtaaagctatgggagccatgggagctgctatt
ctttcttcctcagaagtgaaaacagagttgatgttaaactccccaccattacgctatact
acagcactcgctccccacgccttgattaccataagtgctgcatatgatcatttgtttgta
gcaggggagctcgctcgcaaacaagtttttgcccttcaagagtattttcagcagtatttt
ggtttgagttcccaaggttgtggacaacctattttcttacaggattttaattttgatctt
ttagtttcacttctcaatgaggcgaacttacgcgtaggcttgatgacttttgccgataag
ccttttatacgagtaaatttccacgcttttaatcaccaagatgaagtaaatctcttaatt
gccgttttgcatagctatctagaaaaatgtagttgtaggatcgacgtcaatcatgaattt
tactttgggagacagttttgcagttag

DBGET integrated database retrieval system