KEGG   Cytophaga hutchinsonii: CHU_0300Help
Entry
CHU_0300          CDS       T00385                                 

Gene name
manC
Definition
(GenBank) mannose-1-phosphate guanylyltransferase (GDP)
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
chu  Cytophaga hutchinsonii
Pathway
chu00051  Fructose and mannose metabolism
chu00520  Amino sugar and nucleotide sugar metabolism
chu01100  Metabolic pathways
chu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:chu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CHU_0300 (manC)
   00520 Amino sugar and nucleotide sugar metabolism
    CHU_0300 (manC)
Enzymes [BR:chu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     CHU_0300 (manC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD MannoseP_isomer
Motif
Other DBs
NCBI-ProteinID: ABG57591
UniProt: Q11YC5
Position
359136..360212
Genome map
AA seq 358 aa AA seqDB search
MDINNYAVIMAGGIGSRFWPFSRTKYPKQFHDVLGTGATLIQQTVNRFKNICPPENIIIV
TNKDYVGLVKEQLPFLQDHQILAEPIGRNTAPCLAYASYKILQRDKNANIVVAPSDHIIL
QEKEFENVIVEALQATEQADILITLGMKPTRPDTGYGYIQYIDEKKLRIKKVKTFTEKPA
LELAIKFIESGEFVWNAGIFIFNAQTIVDAIKKHLPEMDEVFTEGSGLYWTDKENDFINK
AYSRCGNISIDYGIMEKSDNVYVMLADFGWSDLGTWKSLFENMPKNDDGNVIDGNVLTYD
AKDTIIKTPKNKLVVVEGLEGYIVAEFDDVLMICRKENEQRVKDFVSDVKATQDKRFV
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggatataaataattatgccgtaataatggcaggggggataggaagcaggttctggccg
tttagccggacaaaatatccgaaacagtttcacgatgtacttggtaccggtgctaccctt
attcagcagacggtaaacagatttaaaaatatttgtccgccggaaaatatcattattgtt
acaaataaggattatgttggcttagtaaaagagcaattaccctttttacaggatcaccag
attcttgctgaacctattggcagaaacacagccccatgtctggcatatgcttcttataaa
atattgcagcgtgataaaaatgcaaatattgttgttgctccatctgatcacattattctg
caggaaaaagagtttgaaaatgtaatagttgaagcacttcaggctacagagcaggctgat
attcttataacattgggaatgaagccaacacgccctgatacaggttatggatatattcag
tatatcgatgagaaaaaactccgtattaaaaaggtaaaaacatttactgaaaaaccggcg
cttgaactggctattaaatttattgaaagcggtgagtttgtctggaatgcagggatcttc
atattcaatgcacagacaattgtagacgccattaaaaaacacttgcctgaaatggacgag
gtgtttacggaagggagcggattatactggacggataaagaaaatgatttcattaataag
gcatattcccgttgcggcaatatttctattgattatgggatcatggaaaaatcagacaat
gtgtatgtaatgctggccgatttcggttggtctgatttaggtacatggaaatcattgttt
gaaaatatgcctaagaatgatgatggaaatgtaatagacggtaatgtacttacgtatgat
gctaaagatactattataaaaacacctaaaaataaacttgtagttgttgaaggcctggaa
ggctatattgtagcggagtttgacgatgtactgatgatctgccgcaaggagaatgagcaa
cgtgtgaaagattttgtttcagatgtaaaagcaacacaggataaacggttcgtgtaa

DBGET integrated database retrieval system