KEGG   Cytophaga hutchinsonii: CHU_1136Help
Entry
CHU_1136          CDS       T00385                                 

Definition
(GenBank) fatty acid desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
chu  Cytophaga hutchinsonii
Pathway
chu01040  Biosynthesis of unsaturated fatty acids
chu01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:chu00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    CHU_1136
Enzymes [BR:chu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     CHU_1136
Lipid biosynthesis proteins [BR:chu01004]
 Desaturase
  First
   CHU_1136
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-ProteinID: ABG58411
UniProt: Q11W05
Position
complement(1309287..1310033)
Genome map
AA seq 248 aa AA seqDB search
MIILLFFVAHWYLSLFMQTFFLHRYAAHQMFTMSKGWEKFFYILTWLFQGSSYLSPYAYG
VMHRLHHTYADTDKDPHSPKYSTGMFDMMWKTKNIYNDILHGRIELDPKYKKNVPYWGFI
EKMGDNWFSRVAWGTAYTLFYVYFATHWWMFLLLPIHYLMGPVHGAIINWFAHKYGYVNF
VVNDTAKNLLPVDFLMFGESYHNNHHKLGGRANFGVKWHEFDPAYPIILFFNAFHIIKLK
RNNDLNYM
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgattatcttactattctttgttgcgcattggtatctatctttatttatgcagacattc
tttctgcaccggtatgccgcacatcaaatgtttaccatgtctaaaggctgggaaaaattc
ttttacatacttacgtggctgtttcagggttcatcttatctgagtccctatgcatatggt
gtgatgcaccgtctgcatcacacctatgcagatacagataaagatccgcactctcctaaa
tattctaccggaatgtttgatatgatgtggaagactaaaaatatttataatgacatttta
cacggacgcatagagcttgatccgaagtataaaaaaaatgtaccttactggggatttata
gaaaagatgggagacaattggttttcacgtgttgcgtggggtactgcctataccctgttc
tatgtatattttgcaacacattggtggatgtttttattactaccgattcattatctgatg
ggccctgtacacggagctattattaattggtttgcccataaatatggttatgtaaacttt
gtagttaatgatacggctaaaaacttactgcctgttgattttctcatgtttggagaaagc
tatcacaacaaccatcacaaacttggtggccgtgctaattttggtgttaagtggcacgaa
tttgatccggcctacccgatcatcttatttttcaatgcctttcacatcatcaaattaaaa
cggaataatgatttgaattacatgtaa

DBGET integrated database retrieval system