KEGG   Cytophaga hutchinsonii: CHU_1716Help
Entry
CHU_1716          CDS       T00385                                 

Gene name
folD
Definition
(GenBank) 5,10-methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
chu  Cytophaga hutchinsonii
Pathway
chu00670  One carbon pool by folate
chu01100  Metabolic pathways
chu01120  Microbial metabolism in diverse environments
chu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:chu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CHU_1716 (folD)
Enzymes [BR:chu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     CHU_1716 (folD)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     CHU_1716 (folD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ABG58983
UniProt: Q11UD1
Position
complement(2018207..2019079)
Genome map
AA seq 290 aa AA seqDB search
MQLLDGKITSDQIKEELKTKVEAIKAKGGKIPHLAAVLVGDSGAAVTYVNAKVKACELVG
FKSTLVKLPETITEADLLAKVAEINADKDIDGYIVQLPLPKHIDEQKVTEAISPDKDVDG
FHPTSLGRMVLNLPTYLPATPYGIMQLLERNGIETSGKHCVVMGRSHIVGSPMSILMARN
TNPGNATVTMVHSRTKNLKELTLQADILIVAIGKPEFVTADMVKEGAVVVDVGIHRIDDA
TKKSGFRLLGDVKFDEVAPKTSYISPVPGGVGPMTIASLLMNTLQAAALK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcaattactagacggtaaaatcacttccgatcagatcaaggaagaactgaagacaaaa
gttgaagctataaaagctaaaggtggtaagatcccgcatttagctgctgtattggtaggc
gatagcggtgctgctgttacctatgtgaatgcaaaggtgaaagcatgtgaactggttgga
ttcaaatcaacactggttaaacttcctgaaacaattacggaagctgatttgcttgcgaaa
gttgcagaaataaatgcagacaaagacattgatggatatattgttcaattgcctttaccc
aaacacatcgatgaacaaaaagtaacggaagccatttctccggataaagatgtggatggc
tttcacccgacaagcttaggccggatggtgttgaatttaccaacctatctgcctgctaca
ccttacggcattatgcagttactggaacgcaacggcattgagacttccggtaaacactgc
gtggtaatgggcagaagtcatattgttggctctcccatgagcatcttgatggcgcgtaat
accaaccccggtaacgcaacggtaaccatggtgcattcccgcacaaagaatttaaaagaa
ctgactcttcaggcagatatattaattgttgccatcggtaagccggaatttgtaacagcg
gatatggttaaagaaggcgcggttgtagtggatgttggtatccaccgtattgatgatgct
acaaaaaaatccgggttcagattattgggagatgtgaagtttgatgaagttgctcccaaa
acttcgtatatttcgcctgtaccgggcggcgtaggtcctatgaccatagcttcactatta
atgaatacactgcaggcagcggctttaaaataa

DBGET integrated database retrieval system