KEGG   Cytophaga hutchinsonii: CHU_2996Help
Entry
CHU_2996          CDS       T00385                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
chu  Cytophaga hutchinsonii
Pathway
chu00900  Terpenoid backbone biosynthesis
chu01100  Metabolic pathways
chu01110  Biosynthesis of secondary metabolites
chu01130  Biosynthesis of antibiotics
Module
chu_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:chu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CHU_2996 (dxr)
Enzymes [BR:chu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     CHU_2996 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: ABG60237
UniProt: Q11QS7
Position
complement(3436304..3437479)
Genome map
AA seq 391 aa AA seqDB search
MKDPQKKYIAILGSTGSIGTQALEVIRNNKDRFVVEVLTAENNAALLIEQAVEFRPNVVV
IGNEGLYSNVQHALEPLDIKVYCGVKALASVVEMEDIDVVLTALVGYAGLIPTIHAIKAG
KHIALANKETLVVAGDIVTALARQHRVAILPVDSEHSAIFQCLPGEGMNEIEKIILTASG
GPFRGMKRADLEHVTKKQALKHPNWSMGAKITIDSASLMNKGLEVIEAKWLFGLEADQID
VVVHPQSIIHSMVQFQDGSIKAQMGLPDMKLPIQYALAFPERLKSDYPRFDFTQYPALTF
DKPDTETFHNLSLAYDALRKGGNMACILNAANEIAVEKFLQDEIAFLEMPDLIAECMAKV
PYIVVPTLDDYIQTDTQTRALARAYTQVKVK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaccctcaaaaaaaatacattgccattcttggatctaccggttcaatcggcaca
caggcccttgaagttatccggaataataaagatcggtttgtggttgaagtgttaacagca
gaaaataatgcagcgctgcttatagagcaggccgttgaatttcgccccaatgtagttgtc
attggaaatgaggggctctattcaaacgttcagcatgccttagagccgctggatataaag
gtgtattgcggagtcaaagcgctggcttcagttgttgagatggaagatatcgatgttgta
ttgaccgcattggtcggttatgccggtttaattccaacgatacatgccatcaaagcaggc
aagcacattgccctggcaaataaagaaacgcttgttgttgcgggtgatatcgttacggca
ttagccagacagcatcgggtagcgatcctgccggttgattctgaacattcagccattttt
cagtgtttgcctggagagggaatgaatgaaattgagaagattattctgacagcttccggt
ggtccgttcagaggcatgaaacgtgcagatctggagcatgtaactaaaaaacaagcctta
aagcatcccaactggagcatgggcgctaaaataacgattgattcggcttccttgatgaat
aaaggcttggaggttattgaagcgaaatggttatttggtctggaagccgatcagattgat
gttgttgtgcatcctcagtcgatcatacattccatggtacagtttcaggatggttccatt
aaagcacagatggggctgccggatatgaaattaccgatacagtatgcgctggcttttcct
gaacggttaaagtccgattatccgaggtttgattttacacaatatccggcccttaccttt
gacaaacctgatacggaaacatttcataatttatcattagcctatgatgccttgcgaaaa
ggagggaatatggcctgtattttaaatgctgctaatgagatcgctgttgaaaaattcctg
caggatgagatagcatttttagaaatgcctgatttgattgctgaatgtatggcaaaagta
ccgtatattgttgttccgacgctggatgattacattcagacagatacacagacaagagcg
ttggcgcgtgcatacacgcaggtaaaagttaaataa

DBGET integrated database retrieval system