KEGG   Cytophaga hutchinsonii: CHU_3296Help
Entry
CHU_3296          CDS       T00385                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
chu  Cytophaga hutchinsonii
Pathway
chu00260  Glycine, serine and threonine metabolism
chu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
chu01100  Metabolic pathways
chu01110  Biosynthesis of secondary metabolites
chu01130  Biosynthesis of antibiotics
chu01230  Biosynthesis of amino acids
Module
chu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:chu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CHU_3296 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CHU_3296 (trpB)
Enzymes [BR:chu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CHU_3296 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABG60535
UniProt: Q11PX8
Position
3768041..3769237
Genome map
AA seq 398 aa AA seqDB search
MNYNVDKKGYYGNFGGAFIPEMLYPNVEELRENYLKIINDESFQKEYQDLLKNYVGRPTP
LYLAKRLSEKYNATIYLKREDLCHTGAHKINNTIGQILIAKRMGKTRIIAETGAGQHGVA
TATACALMGMPCVVHMGAVDMDRQKPNVERMRMLGAEVIPAMTGSRTLKDATNEALRDWI
NNPVDTFYIIGSVVGPHPYPDMVARLQAVISEEIIDQLQETTGNPDPTHVIACVGGGSNA
AGSFYHFLDRPNVELIAVEAAGEGVYSGYSAATTFLGKPGVLHGSKTLLMQTEDGQVVEP
HSISAGLDYPGIGPMHANLFETGRAKFFSITDKEAFQAAFMLARTEGIIPALESAHAVAA
LENIALKKSDVVVVNLSGRGDKDMMTYITRKEEFLTNN
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaactataacgtagataaaaaaggatactatggaaatttcggtggagcgtttattccc
gaaatgctgtatcccaatgttgaagaacttcgtgaaaattatttaaagattatcaacgat
gaatcttttcaaaaggaatatcaagacctccttaaaaattatgtaggcagacctactcct
ttgtatttggcaaaacgcttatctgaaaaatataacgctaccatttatttaaagcgtgaa
gatctgtgtcacacaggtgcacacaagatcaacaatacgatcggccagatcctgatcgca
aagcgtatgggtaaaacccgtattattgctgaaacaggtgccggccagcacggtgttgca
acggctacagcctgtgcattaatgggcatgccgtgtgtggtgcatatgggcgctgttgac
atggacagacaaaaaccaaatgttgagcgcatgcgcatgttaggtgctgaagttatacct
gctatgaccggtagccgcacgctgaaagatgcgacaaacgaagcgttacgcgattggatc
aataacccggttgatacattctatatcattggttctgttgtggggccgcacccatatccg
gatatggttgcccgcttacaggcagtaatcagcgaagagattattgatcagctgcaggaa
acaaccggtaatcctgatcctacacatgtgattgcatgcgttggcggcggcagtaatgca
gccggttcgttttatcatttccttgatcgcccgaatgtagaattgattgctgttgaagct
gcaggtgaaggtgtatattccggttattctgccgcaactacgttcttaggtaaaccaggt
gtgttgcacggcagcaaaaccttgctgatgcagacagaagatggtcaggttgtagaacca
cattctatttctgcaggcctggattatccgggcatcgggcccatgcatgccaacttattt
gaaaccggccgtgcaaaattctttagcataacagataaagaagcgttccaggccgcattc
atgctggctcgtacagaaggcatcattcctgctttggaatcagcgcatgcagtggccgcc
cttgaaaatattgcattgaaaaaatctgatgtggtagttgtcaatttatccggccgcggc
gataaagatatgatgacatacattacaagaaaagaagaattcttaacaaacaactaa

DBGET integrated database retrieval system