KEGG   Campylobacter helveticus: CHELV3228_0099Help
Entry
CHELV3228_0099    CDS       T04807                                 

Gene name
putA
Definition
(GenBank) proline dehydrogenase / 1-pyrroline-5-carboxylate dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
chv  Campylobacter helveticus
Pathway
chv00250  Alanine, aspartate and glutamate metabolism
chv00330  Arginine and proline metabolism
chv01100  Metabolic pathways
chv01110  Biosynthesis of secondary metabolites
chv01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:chv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CHELV3228_0099 (putA)
   00330 Arginine and proline metabolism
    CHELV3228_0099 (putA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:chv03000]
    CHELV3228_0099 (putA)
Enzymes [BR:chv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     CHELV3228_0099 (putA)
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     CHELV3228_0099 (putA)
Transcription factors [BR:chv03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    CHELV3228_0099 (putA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh
Motif
Other DBs
NCBI-ProteinID: ARE79772
UniProt: A0A1V0RDU2
Position
complement(97048..100548)
Genome map
AA seq 1166 aa AA seqDB search
MIQKSLALAETLQNKIEQNLSSSERAFHAKMQKLLNNPQNKVMLIELLDRSFRCKDRAAS
FELIEHTLHKFGIADFFSAFEKFLLLCFLNAGRFVPKLSVPFFISHLRNDTKAMVLDSNE
SFLSPHIAKRKSEQNITLNVNLIGEEVLGEAESHYRMQKYEEALKSSYITYISIKITTIF
SQINIIDFDYSKAEVVKRLDTLYALALEEEKRQGVSKFINLDMEEFRDLELTVAAFMESV
SKFDIKAGIVLQAYIPDSYEYLKILLAFSKERVEKGMKPIKIRFVKGANMESEETIASQR
GWELPTFHRKIDTDSNYNKMLDLVLENENYKYINIGIASHNIFEIAYAYTRIMEAGAGES
FTFEMLEGMSLQCSYELSKMHNLILYAPVCDEAHFNNAIAYLVRRLDENTSEDNFMRHFF
NLKVSSKAWEEQKNLFLDSLKGIASLDNSTHRKQDRTKVQKVLSSYESKQFNNESDTDFI
LPQNRLWAQEIKAKYENLTHFNVYPVAGDMDFTQENLNALEVGDKIENRPIGRAYLAGEK
QIAHALKVAKDSNFSQKSSDEIYKILSKAAQLLRERRGDLIGIAALETGKTFLEIDPEVS
EAIDFVEFYPHSLEKLKSQNPKTTFKPKGIGVTIAPWNFPVGISVGTIAAPLAAGNVVIY
KPSSLSTLTGYKLCECFWDAGIPKDALIFLPAKGRDISTYLLSDEAVKFSILTGGEDTAY
AMLKANPTLLLSAETGGKNATIVSKFADRDSAVKNIIHSAFSNSGQKCSATSLLVLEDEV
YNDEEFKKALVDAAQSLAVGSPFVFKNKLGALCDKPSEKVLKAINELESGEEWALKPTFV
NDNPHLMTPGIKYGVKRGAFTHMNELFAPILSVMKAKDLQDAIEIVNATGYGLTAGFESL
DEREWEYFHTHIEAGNIYINKPTTGAIVLRQPFGGVKKSAIGFGRKVGIYNYITQFMDIE
SESDENLSGNHFSQAMQKLDISAEKSDKQALENAKIMAQSYAYHHRHEFSVAKDYVHIRG
EDNLFSYTKIKNCGFRVSDDDSLQDILGVILGANTADVPLSISYESHEQIALAKELCKAV
GLNAEFAKESKEDFIAKMASFERIRYHAKADKSDPLYQAAAKEAKIIIREKPLLNGRFEL
LYYHNEKALSISYHRYGNLGIRALKH
NT seq 3501 nt NT seq  +upstreamnt  +downstreamnt
atgatacaaaaatccctagccctagccgaaacgctacaaaataaaatagagcagaatctc
tcttctagcgagcgagcatttcacgccaaaatgcaaaagctcctaaataatccccaaaat
aaagtaatgctgatagagctgctagaccgctcctttcgctgcaaggatagggcagcgagc
tttgagcttatagagcatacactgcataaatttggcatagcggactttttctctgcgttt
gagaaatttttgcttctttgctttttgaatgctgggcgatttgtccctaagcttagcgtg
ccatttttcatctcgcatttgcgtaatgatactaaggctatggtgctagattctaatgaa
agctttttatcgcctcacatcgctaaacgcaagagtgagcaaaatatcacgcttaatgtc
aatctcatcggcgaagaggtgctgggcgaggcggagagccattaccgaatgcaaaaatac
gaagaagccctaaaatcaagctacatcacttacatttctatcaaaatcactacgattttt
tcacagattaacattatagattttgactactctaaggctgaagtggtaaaacggcttgat
acgctctacgctctagcacttgaagaggagaaaaggcagggtgtgagcaaatttatcaat
cttgatatggaggagtttagggatttagagctgactgtggcggcgtttatggagagtgtg
agtaaatttgacatcaaagctggaatcgtgctgcaggcttatatcccagattcttatgag
tatcttaagattctgcttgccttttcaaaagagcgggttgagaagggaatgaagcctatt
aaaatccgctttgttaagggtgcaaatatggagagtgaagagaccatagcaagccaaaga
ggctgggagctaccgacctttcatcgcaagattgacactgatagcaactacaacaaaatg
ctagatttagtcctagaaaatgaaaattacaaatacattaacatcggtattgcaagtcat
aatatctttgaaatcgcctatgcctatacgcgtattatggaagctggagcgggtgagagc
tttacttttgaaatgctagagggtatgagcttgcaatgctcttatgagctatctaaaatg
cacaatctcattttatacgcgcctgtgtgtgatgaagcgcattttaataacgccattgct
taccttgtgcgccgtttagatgaaaacacaagcgaagataattttatgcgccattttttc
aatctcaaagtgagctccaaagcgtgggaggagcaaaaaaatctctttttagattctctt
aaaggtattgctagccttgataactccacgcacagaaagcaagataggacaaaggtgcaa
aaagtgctaagctcgtatgagagtaagcagtttaacaatgaaagcgatacggattttatc
ctgccacaaaatcgcctatgggcgcaagaaatcaaggcaaaatacgagaatttaacgcat
tttaatgtctatcctgtggctggggatatggacttcacacaggagaatctaaatgctcta
gaagtgggagataaaattgagaatcgccctatcggcagagcctatctcgcaggggaaaaa
caaatcgcccacgcgttaaaagtagcaaaagattctaacttttctcaaaaaagtagtgat
gagatttataagattctttcaaaagccgcgcagcttttacgcgaacgcaggggggattta
atcggtatagctgcgcttgaaacgggcaagacatttttagagattgacccagaggtgagt
gaggcgattgactttgtggagttttatccgcattcactagaaaagctcaaatcgcaaaat
cccaaaacgacctttaaacccaaaggcataggcgttactatcgcgccgtggaatttccct
gtgggcatttctgtggggaccattgccgcgcccttagcggctgggaatgtggtgatttat
aagccctcttcactctccacgctcacaggctataagctttgcgagtgtttctgggacgct
gggattccaaaagatgcgctaatattcttgcctgcaaagggcagggatatttctacttat
cttttaagcgatgaagcggtgaaattctctattcttacaggcggagaggatacggcgtat
gcgatgttaaaggcaaatcctactttgcttttaagtgctgagacagggggtaaaaatgcc
accatcgtatcaaaatttgccgatagggatagcgcggtgaaaaacattatccactccgcg
ttttcaaattctgggcaaaaatgctcggctacttcgctgcttgtgctagaagatgaagtc
tataatgatgaggagtttaaaaaagcccttgtagatgccgcgcaatcgcttgccgtggga
agtccatttgtatttaaaaataaactcggcgcactgtgtgataaaccaagtgagaaagtg
ctaaaagctataaacgagctagaatctggcgaggagtgggcattaaagcctacatttgtg
aatgacaatccacaccttatgacaccgggcattaaatacggcgtgaaaaggggagctttc
acgcatatgaatgagcttttcgcgcctattcttagcgtgatgaaggcaaaagatttgcaa
gatgctattgagatagtcaatgccacaggctatgggcttacggctgggtttgaaagccta
gatgaaagagagtgggagtatttccacacgcacattgaagcgggaaatatctatatcaat
aagccaaccactggtgctatcgtgctgcgtcagccttttggtggggtgaaaaagtccgct
atcggctttgggagaaaggtggggatttataactacatcacgcagtttatggatatagaa
tcagaatctgatgagaatctatcggggaatcacttctcacaagccatgcaaaagcttgat
ataagcgcggaaaaaagcgataaacaagccctagaaaatgcaaaaataatggcgcaatcc
tatgcctatcatcacaggcacgaatttagcgtggcaaaggactatgtgcatatccgcggc
gaggataatcttttctcctatacaaaaatcaaaaattgcggctttagagtgagtgatgat
gatagtttgcaagatattttgggcgtgattctgggagcaaataccgctgatgtcccgcta
tctatcagctatgaatctcacgagcaaatcgccctagctaaagagctatgcaaggcagtg
gggcttaatgcggaatttgcaaaggagagcaaggaagactttatcgctaaaatggcttca
tttgagagaatccgctatcacgctaaggcggataaaagcgacccactctatcaagccgct
gcaaaagaggcgaaaatcattatccgtgaaaagcccttgctgaatggacgctttgagcta
ctctattatcacaacgaaaaggcgttaagcatatcctatcatcgctatgggaatctcggc
atacgcgccttaaaacattaa

DBGET integrated database retrieval system