KEGG   Campylobacter helveticus: CHELV3228_0233Help
Entry
CHELV3228_0233    CDS       T04807                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
chv  Campylobacter helveticus
Pathway
chv00071  Fatty acid degradation
chv00072  Synthesis and degradation of ketone bodies
chv00280  Valine, leucine and isoleucine degradation
chv00310  Lysine degradation
chv00362  Benzoate degradation
chv00620  Pyruvate metabolism
chv00630  Glyoxylate and dicarboxylate metabolism
chv00640  Propanoate metabolism
chv00650  Butanoate metabolism
chv00900  Terpenoid backbone biosynthesis
chv01100  Metabolic pathways
chv01110  Biosynthesis of secondary metabolites
chv01120  Microbial metabolism in diverse environments
chv01130  Biosynthesis of antibiotics
chv01200  Carbon metabolism
chv01212  Fatty acid metabolism
chv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:chv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CHELV3228_0233
   00630 Glyoxylate and dicarboxylate metabolism
    CHELV3228_0233
   00640 Propanoate metabolism
    CHELV3228_0233
   00650 Butanoate metabolism
    CHELV3228_0233
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CHELV3228_0233
   00072 Synthesis and degradation of ketone bodies
    CHELV3228_0233
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CHELV3228_0233
   00310 Lysine degradation
    CHELV3228_0233
   00380 Tryptophan metabolism
    CHELV3228_0233
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CHELV3228_0233
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CHELV3228_0233
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CHELV3228_0233
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chv04147]
    CHELV3228_0233
Enzymes [BR:chv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CHELV3228_0233
Exosome [BR:chv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CHELV3228_0233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ARE79887
UniProt: A0A1W1XBW0
Position
215041..216228
Genome map
AA seq 395 aa AA seqDB search
MKTQEVVIMAAKRTAIGSFLGSLKQTTAVQLASSLSQSLLDEVGLDKNLIDELILGQVLG
AGCGQNVARQVLINSGVSLEKTAFVVNMLCGSGLKAVQLGFDSIRFNNANMLLCGGVENM
SLSPFLLENARLGYKMGHQNLIDSMIKDGIWCALSDCHMGITAENLAKKYELSREEQDEF
ALNSQLKASKAIENKAFGAEILPLKIQDKKKEFIFSEDEFVRKDANLEALSRLKPAFDKN
GSVTAGNSSGVNDGAAMLLLSSKEKALELNLPILAKLKGFASVGVEPSIMGIGAAFAAKK
VLKELDLSIDDMELIEANEAFAAQSLATLRELGADVNRVNVNGGAIALGHPIGASGARIL
VSLIYALRARGKNLGLATLCVGGGQGIAAVVEIER
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacacaagaagtggttataatggctgcaaaaaggacagctatcggctctttttta
ggcagtttaaagcagacaacagccgtccagcttgcaagttcactttctcaatctttgctt
gatgaagtgggattagataaaaatttgattgatgagcttattttgggacaagttttgggg
gcgggttgtgggcaaaatgtggcgcgacaagttcttataaatagtggtgtaagcttggaa
aaaacggcttttgttgttaatatgctttgcggttcgggcttaaaagctgtccagcttggc
tttgactcgattcgttttaataatgcaaatatgcttttatgtggcggtgttgaaaatatg
tctttatcgccttttttacttgaaaatgctaggcttggttataaaatggggcatcaaaat
ttaatcgatagtatgattaaagatggaatttggtgtgctttgagtgattgtcatatgggc
attaccgcagaaaatttagctaaaaaatatgagctttcacgcgaagagcaagacgaattt
gcgctcaattctcaattaaaagcctcaaaagctattgaaaataaagcctttggggcggaa
attttgcctttaaaaattcaagataagaaaaaagaatttatctttagtgaagatgaattt
gtgcgtaaagatgcaaatttagaagctttatcgcgtttaaaacctgcctttgataaaaat
ggctctgttaccgctggtaactcttcgggggttaatgatggggcagctatgttattgtta
agttctaaagagaaagcacttgagttaaatttacccattttagcgaagcttaaaggtttt
gctagtgtgggtgtagagcctagcattatgggtataggtgcggcttttgcggcgaaaaag
gtgcttaaagaacttgatttaagtattgatgatatggagcttatagaggcaaatgaagct
tttgcagcccaaagtttagccacgcttagagagcttggggctgatgtaaatagggtaaat
gttaatggtggggctattgctttgggacatcccataggtgcgagtggagcaaggatattg
gtaagtcttatttatgccttaagagctaggggcaaaaatttaggtttggcgactttgtgc
gttggtggcggacagggaattgctgctgtagttgagatagaaaggtaa

DBGET integrated database retrieval system