KEGG   Campylobacter helveticus: CHELV3228_0878Help
Entry
CHELV3228_0878    CDS       T04807                                 

Gene name
dfp
Definition
(GenBank) phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
chv  Campylobacter helveticus
Pathway
chv00770  Pantothenate and CoA biosynthesis
chv01100  Metabolic pathways
Module
chv_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:chv00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    CHELV3228_0878 (dfp)
Enzymes [BR:chv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     CHELV3228_0878 (dfp)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     CHELV3228_0878 (dfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein
Motif
Other DBs
NCBI-ProteinID: ARE80471
UniProt: A0A1V0RFB1
Position
851095..852243
Genome map
AA seq 382 aa AA seqDB search
MKTILLAISGSIAFYKSYELISLFKKEGFRVKVLLSNGLLKFATKLSFEALADAILCEEN
ESWQSQNNHIAFSKDADIVLFAPASVNSINKLANGISDTLFIQTLMAAKAPIIIAPAANS
AMYLHFSTQKSLQILKQNGVKIIEPIYKKLACKDEGIGALAEIEDIFHFIKRELFKEEFF
CGKSVIVSGGGTKEKIDDVRCISNFSSGKMAKELAFAFYYLGADVVLLSSVEFKTPFQFL
AFESSKDLKALLKRFEEGDFLIMCAAVSDFVPKYQKGKIKKSEAGLNLELNLNEDLLKTC
KFKGKKIGFKMELDAQNALKNAELSLKEKKLDMVCLNVLGEKNHFGADFNELIFITQDES
ARSGFKSKKVLAFELAKMCQKL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccatacttttagctatcagcggtagtatagcgttttataagtcgtatgagctt
atttctttgtttaaaaaagagggctttagggttaaggtattgcttagtaatggacttttg
aaatttgcgaccaagcttagttttgaagctttagccgatgcaattttatgtgaggaaaat
gaaagttggcaaagtcaaaataatcatatcgcctttagcaaggacgctgacattgtgctt
tttgctccggcgagtgttaattccattaataaacttgcaaatggcattagtgatactctt
tttatccaaaccttaatggcagcaaaagctcccattatcatcgctccagcggcaaattcg
gcgatgtatttgcattttagcacacaaaaatccttgcaaattttaaaacaaaacggcgtt
aaaatcatagagccgatatataaaaaacttgcgtgtaaagacgagggcataggggcttta
gcagagatagaggacatttttcacttcattaaaagagagctttttaaggaggagtttttt
tgcggtaaaagcgtgattgtaagcgggggtggcacgaaagaaaaaattgatgatgtgcgt
tgcattagcaatttttctagtggaaaaatggcaaaagaacttgcctttgctttttattat
ttaggtgctgatgtcgtgctacttagctcagtggaatttaaaacgccctttcagtttctt
gcctttgaaagctcaaaggatttaaaggcacttttaaagcgttttgaggagggtgatttt
ttgataatgtgtgcggcggtgagtgattttgtgccaaaatatcaaaaaggcaagattaaa
aaaagcgaagcggggttgaatttagagcttaatttaaatgaggacttgcttaaaacttgc
aaatttaaaggcaaaaaaataggctttaaaatggagcttgacgcacaaaatgccctgaaa
aatgcagagctttctttaaaagaaaaaaagcttgatatggtttgtcttaatgttttaggt
gaaaaaaatcattttggtgcggattttaatgagcttattttcatcacgcaagatgaaagc
gcaagaagcggttttaaaagtaaaaaagtccttgcgttcgaacttgctaaaatgtgtcaa
aaattatga

DBGET integrated database retrieval system