KEGG   Campylobacter helveticus: CHELV3228_0922Help
Entry
CHELV3228_0922    CDS       T04807                                 

Gene name
fbp
Definition
(GenBank) fructose-1,6-bisphosphatase I
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
chv  Campylobacter helveticus
Pathway
chv00010  Glycolysis / Gluconeogenesis
chv00030  Pentose phosphate pathway
chv00051  Fructose and mannose metabolism
chv00680  Methane metabolism
chv01100  Metabolic pathways
chv01110  Biosynthesis of secondary metabolites
chv01120  Microbial metabolism in diverse environments
chv01130  Biosynthesis of antibiotics
chv01200  Carbon metabolism
Module
chv_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:chv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CHELV3228_0922 (fbp)
   00030 Pentose phosphate pathway
    CHELV3228_0922 (fbp)
   00051 Fructose and mannose metabolism
    CHELV3228_0922 (fbp)
  09102 Energy metabolism
   00680 Methane metabolism
    CHELV3228_0922 (fbp)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chv04147]
    CHELV3228_0922 (fbp)
Enzymes [BR:chv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     CHELV3228_0922 (fbp)
Exosome [BR:chv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CHELV3228_0922 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase Inositol_P
Motif
Other DBs
NCBI-ProteinID: ARE80514
UniProt: A0A1V0RFF8
Position
893651..894496
Genome map
AA seq 281 aa AA seqDB search
MQELIKLIQEAVIEISNELKFPDTTYSDEKNSSGDTQLKFDVLSDEIITKRLSTSKSLKA
LISEEKEETLHLNENGKFIVAYDPLDGSSLMDVNFAIGSIFAIYEEKVSAKNLKAALYSV
YGARLELVFCEGDEVKLYRLDKSGAFSYVKELKMAEKGKINATGGTQKFWEEKHAAFIKS
LFEEGYRLRYSGAMVSDIHQILLKGGGLFSYPATKDAPNGKLRAFFEIFPLAFIIEKAGG
KTTDGKKHSLLELEFDKIHATSPCFFGSKYEITKLLKAYNG
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagagttaattaaactaatccaagaagccgtgatagaaatttcaaacgagcttaaa
tttccagacaccacatatagcgatgaaaaaaattcaagtggcgacactcagcttaaattt
gatgttttaagcgatgaaatcatcacaaaacgcttaagcacaagcaaaagcttaaaggcg
ctcattagcgaagaaaaagaagaaacacttcacctcaatgaaaatggcaaatttatcgtt
gcttacgacccacttgatggctcttctttaatggatgttaattttgccataggttctatt
tttgccatttacgaagaaaaagtttcggctaaaaatttaaaagcggcactttatagcgtt
tatggtgctagacttgagcttgttttttgcgaaggtgatgaagtgaaactttaccgcctt
gacaaaagtggtgcatttagctatgtcaaagagcttaaaatggctgaaaaaggtaagata
aacgccacaggtggcacacaaaaattttgggaagaaaaacacgctgcttttattaaaagc
ctttttgaagagggttatagactaagatatagtggggctatggtaagtgatattcatcaa
attttattaaaaggcggagggctttttagctatcccgcaacaaaagatgctccaaatgga
aaattaagagctttttttgaaatttttccccttgctttcatcatagaaaaagcagggggg
aaaacgacagacggcaaaaagcactccttgcttgagcttgaatttgacaaaattcacgcc
accagcccttgcttttttggtagcaaatatgaaatcaccaagcttttaaaggcgtataat
ggctga

DBGET integrated database retrieval system