KEGG   Campylobacter helveticus: CHELV3228_0924Help
Entry
CHELV3228_0924    CDS       T04807                                 

Gene name
metS
Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
chv  Campylobacter helveticus
Pathway
chv00450  Selenocompound metabolism
chv00970  Aminoacyl-tRNA biosynthesis
chv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CHELV3228_0924 (metS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CHELV3228_0924 (metS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:chv01007]
    CHELV3228_0924 (metS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:chv03016]
    CHELV3228_0924 (metS)
Enzymes [BR:chv01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CHELV3228_0924 (metS)
Amino acid related enzymes [BR:chv01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CHELV3228_0924 (metS)
Transfer RNA biogenesis [BR:chv03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CHELV3228_0924 (metS)
 Prokaryotic type
   Other AARSs
    CHELV3228_0924 (metS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f Collar Zn-ribbon_8
Motif
Other DBs
NCBI-ProteinID: ARE80516
UniProt: A0A1V0RFN7
Position
894687..896567
Genome map
AA seq 626 aa AA seqDB search
MRYITTPIYYVNDVPHLGHAYTTIIADTLARFYRLSGHKTLFLTGTDEHGQKIEQAAKNK
NHSPKEYADKISLDFKKLWDEFEISYDIYARTTDERHIKFVKQIFLKMWEKGDIYKGEYE
GYYCVSCESFFTQSQLISQCGCPDCGKETKLLKEESYFFRLSKYEKNILKWYESEPIVPK
NKKAELVNFIENGLKDLSITRTSFEWGIKIPSNLNDDKHIIYVWLDALFIYISSLELDEK
SENLGFLPAFVHLVGKDILRFHAIYFPAFLMSVGLPLPKHIAAHGWWTRDGEKMSKSKGN
ALYPKIIADAYGLEAFRYFLLREVPFGNDGDFSETMLINRINADLSNEFGNLLNRIIGMS
LKYSNGNILQDEVLNFYKAELKEANLHLQNALEFIENFQFNRYLEELFKALSVANLSISK
YEPWNLIKNNETSKANALVSLCANILAKVSVLLHPTLPKSTQKVAKALNYEINPQIYQKL
IQQNELLNFKASACEALFPKVEKALLTSPKKEEEKQVMPKIKIEDFAKIELKVALVKECE
KIEGSEKLLKFILELENGETRQVLSGIAKFYQPKELIGKQVCLISNLKKAKIFGYESDGM
ILSAKSGDKLVLISPQSLVENGSLIG
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatattactacaccgatttattatgtgaatgatgtccctcatttaggacacgct
tatacaacgattattgccgatactttggcgcgtttttatcgccttagcggacacaaaaca
ctttttttaacaggcacagacgaacacggacaaaaaatcgaacaagccgctaaaaataaa
aatcacagccctaaagaatacgccgataaaatcagtcttgattttaaaaaactctgggac
gaatttgagataagctatgatatttacgcacgcaccacagatgaaaggcatattaaattt
gtcaaacaaatttttttgaaaatgtgggaaaaaggcgacatttataagggtgaatatgaa
ggatattactgcgtttcttgcgaaagtttttttacgcagtctcaactcatctcacaatgc
ggttgtcctgattgcggaaaagaaacgaaacttttgaaggaagaaagctatttcttcagg
ctttcaaaatatgaaaaaaatattttaaaatggtatgaaagcgaacccatagtgcctaaa
aataaaaaggcagaacttgtcaattttatagaaaatgggcttaaagacctctccattaca
cgcacaagctttgagtgggggattaaaattccgtcaaatttaaacgatgataagcatatc
atttatgtatggcttgatgctttgtttatttacattagctcactagaacttgatgaaaaa
agcgaaaatttaggctttttacccgcttttgtgcatttagtgggtaaagatatcttgcgt
tttcacgcgatttattttcctgcttttttaatgagcgtaggcttacctctaccaaaacac
atcgccgcacacggctggtggactagggacggagaaaaaatgagcaagtcaaaaggtaat
gccctctatccaaaaatcatcgccgatgcctatggtttggaggcttttcgttatttttta
ttaagagaagtgccttttggaaatgatggagattttagcgaaacaatgcttattaaccgc
attaatgccgatcttagtaatgaatttggaaatttattaaaccgcattataggaatgagt
cttaaatactcaaatggcaatattttgcaagatgaagttttaaatttttataaagcagag
ttaaaggaagcaaatttacatcttcaaaatgccctagaattcatagaaaattttcaattc
aatcgctatttagaagagctttttaaggctttgagtgtagcaaatttaagcataagcaaa
tatgagccttggaatttgataaaaaacaatgaaacaagcaaggcaaatgctctagtttcc
ttatgtgctaatattttagctaaggtgagtgtgcttttacaccctaccctaccaaaaagc
acacaaaaggttgctaaagctttaaattacgagattaatccacaaatttatcaaaagctt
atccagcaaaacgagcttttaaattttaaagcaagtgcttgtgaggcgttatttccaaag
gtagaaaaagcgcttttaacttctccaaaaaaagaagaggaaaagcaagtaatgcctaaa
attaagatagaagattttgctaaaatcgagcttaaggtagccttagtaaaagaatgcgaa
aaaattgaaggaagtgaaaaacttttaaaattcatacttgagcttgaaaatggcgaaaca
aggcaagtgctttcagggatagccaaattctatcaaccaaaagagctaataggcaaacaa
gtttgcctcataagcaatcttaaaaaagcaaaaatttttggttatgaaagtgatgggatg
atactttcagcgaaaagtggagataaactcgtgctaatcagcccacaaagcctcgtagaa
aacggctctttaataggctga

DBGET integrated database retrieval system