KEGG   Campylobacter hepaticus: A2J15_002225Help
Entry
A2J15_002225      CDS       T05589                                 

Definition
(GenBank) biotin/lipoyl-binding protein
  KO
K01960  pyruvate carboxylase subunit B [EC:6.4.1.1]
Organism
chw  Campylobacter hepaticus
Pathway
chw00020  Citrate cycle (TCA cycle)
chw00620  Pyruvate metabolism
chw01100  Metabolic pathways
chw01120  Microbial metabolism in diverse environments
chw01200  Carbon metabolism
chw01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:chw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A2J15_002225
   00620 Pyruvate metabolism
    A2J15_002225
Enzymes [BR:chw01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     A2J15_002225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 HlyD_3
Motif
Other DBs
NCBI-ProteinID: AXP08545
Position
445636..447438
Genome map
AA seq 600 aa AA seqDB search
MAKKFIDIMDTSFRDGFQSVFGARVLMDDFFPAVEAAKQAGITHFEFGGGARFQSLYFYL
NEDAFAMMDRFRSIVGKEMNLQTLARGVNTVTLDTGSRELIDLHAKLFAKHGTTTIRNFD
ALNDINNLKFSAQCIVKYGLKHELAITLMDLPPNCKGAHDLAFYEKILKDILQAEIPFDS
ICFKDASGTSNPNKIYQTIKMARKILPQNTHIRLHTHETAGVSIACYLAALQAGVDGIDL
AAAPVSGGTSQPDILTMMHALKGQDYDLGGLEEEKILKYEEVLKECLKDYFLPHEASMVN
PIIPFSPMPGGALTANTQMMRDNNILDKFPQIIHAMREVVEKGGFGTSVTPVSQFYFQQA
FNNVMFGPWKKIAQGYGKMVLGYFGKTPVSPDPKIIELAAKELNLEPTTELAIDIADKDE
TKSIAYVKSLLEKEGIVISEENIFIAAACKEKGIAFLKGEAKLNVRKILTNDLAPTKLDQ
NKFTVAVNGNKYHVEVSYGFDKDVNIKNVKKIKENIPNSSSDLNVYDNIENKIITDVSGN
VFKININKNQEVKSGQVIMILEAMKMEIEVNAPKDGIISDLCVKIGDTVNEGQILALYKN
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaaaattcatcgatatcatggacaccagttttagagatggttttcaatctgtt
tttggagctagagttttaatggatgatttttttcctgctgttgaagcagcaaaacaagca
ggtattacacattttgaatttggtggaggggctagatttcaaagtttatatttttatctt
aatgaagatgcttttgccatgatggatagatttagatctatagtaggaaaagaaatgaat
ttgcaaactttagcaagaggtgtaaacactgtgactttagatacaggaagcagggaactt
attgatttgcatgcaaaactttttgctaaacatggtaccacaactataagaaattttgat
gcattaaatgatattaataatttaaaatttagtgcccaatgtatagtaaaatatggctta
aaacatgaacttgctattactttaatggatttacctccaaattgcaaaggtgctcatgat
cttgctttttacgaaaaaattttaaaagacattttacaagctgaaattccttttgatagt
atttgttttaaagatgctagtggaacttcaaatccaaataaaatttatcaaaccattaaa
atggctagaaaaattctaccgcaaaacacacatataagattgcatactcatgaaacagct
ggggtaagtatagcctgttaccttgcagcacttcaagcaggggttgatggcatagattta
gcagctgctccagtaagcgggggaacttctcaacctgatattttaaccatgatgcatgct
ttaaaagggcaagattatgatcttggtggacttgaagaagaaaaaatcttaaaatatgaa
gaagttttaaaagaatgcttaaaagactattttttacctcatgaagcaagcatggtaaat
cctattatccctttttcccctatgccaggaggcgctttaacagcaaatactcaaatgatg
agagataacaatatcttagataaatttcctcaaatcatccatgctatgcgtgaagttgtt
gaaaaaggaggatttggcacttctgtaactcctgtttctcagttttatttccaacaagct
tttaataatgtcatgtttggaccttggaaaaaaatcgcacaaggatatggtaaaatggtc
ttaggttattttggaaaaactccagttagtcctgatccaaagatcattgaacttgctgct
aaagagttaaatttagaacctaccacagaacttgctattgatatagctgataaggatgag
accaaaagtatagcttatgttaaaagcttgcttgaaaaagaaggtatagtaattagtgaa
gaaaatatttttattgcagcagcatgtaaagaaaagggtatagcctttttaaaaggtgaa
gctaagcttaatgtacgcaaaatcttaaccaatgatcttgctcctactaaattagatcaa
aacaaatttactgttgcagtaaatggtaataaatatcatgttgaagtaagttatggtttt
gataaggatgttaatattaaaaatgtaaaaaaaataaaagaaaatataccaaattcatct
tctgatttaaatgtttatgataatatagaaaataaaattataacagatgtttcaggtaat
gtttttaaaatcaatatcaataaaaaccaagaagtaaaatcaggacaagttattatgatt
ttagaagcaatgaaaatggagattgaagtaaatgccccaaaagatggcataatttcagat
ctttgtgttaaaataggtgacacagttaatgaaggtcaaattttagcactttataaaaat
taa

DBGET integrated database retrieval system