KEGG   Campylobacter hepaticus: A2J15_002565Help
Entry
A2J15_002565      CDS       T05589                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
chw  Campylobacter hepaticus
Pathway
chw00564  Glycerophospholipid metabolism
chw01100  Metabolic pathways
chw01110  Biosynthesis of secondary metabolites
Module
chw_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:chw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    A2J15_002565
Enzymes [BR:chw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     A2J15_002565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: AXP08609
Position
complement(518101..518901)
Genome map
AA seq 266 aa AA seqDB search
MSFSKQSSRLFGFVSKCKFPKFIQKIINEKYVNYFKIDMSEFKNSYEYDSLNALFTRSLE
IPRKLDEGFISPCDGKILECGHTFLAKEEHFAFSIKGCTYSVEELLRDNFEKEELKNGLD
YVNIYLSPKDYHRYHSPCNMQILSASYISGMLYSVNEKSLKHVGNLYVKNERVSLKCQTQ
KGIFWLVFIGAQNVGKMRFNFDASIQTNAKISHNFTRKYTDLMISKAQELGNFELGSTIV
LISQKGLFDYKLKIEQNVKFGEKIAD
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgagtttttcaaagcaaagttcaagattatttggttttgtatcaaaatgtaaatttcca
aaatttatacaaaaaataattaatgaaaaatatgtaaattattttaaaattgatatgagt
gaatttaaaaattcctatgaatatgacagtttaaatgcactttttacaagatctttagaa
attccaagaaaacttgatgaaggctttattagtccttgtgatggtaaaattttagaatgt
ggtcatacttttttagctaaagaagagcattttgctttttctattaaaggctgtacttat
agtgttgaagaacttttaagggacaattttgaaaaagaagaattaaaaaatggacttgat
tatgttaatatttatctttccccaaaagattatcatcgttatcatagtccttgcaatatg
cagattttaagtgcaagttatataagcgggatgctttatagtgtaaatgaaaaatcttta
aaacatgttggtaatttatatgtaaaaaatgaaagagttagtttaaaatgtcagactcaa
aaaggtattttttggcttgtttttattggggcacaaaatgtgggtaaaatgcgttttaat
tttgatgcaagcatacaaactaatgcaaaaatttctcataattttacaaggaaatataca
gatttgatgattagtaaagcacaagaattgggtaattttgaattaggatccaccatcgtt
ttgatttctcaaaaaggtctttttgattataagcttaaaatagagcaaaatgtaaaattt
ggagaaaaaattgctgattaa

DBGET integrated database retrieval system