KEGG   Campylobacter hepaticus: A2J15_002725Help
Entry
A2J15_002725      CDS       T05589                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
chw  Campylobacter hepaticus
Pathway
chw00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:chw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    A2J15_002725
Enzymes [BR:chw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     A2J15_002725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AXP08639
UniProt: A0A424Z2M6
Position
complement(548602..549381)
Genome map
AA seq 259 aa AA seqDB search
MNTEFQGKTLVISGGTRGIGKAIVYEFAKVGVNIAFTYNSNAQIAQDMVKDLQRTYKIKA
KAYEFNILEPQTYKELFEKIDIDFDRVDFFISNAIISGRAVVGGYTKFMKLKPKGINNIF
TATVNAFVVGAQEAAKRMEKIGGGSIISISSTGNLVYIENYSGHGTAKAAVEAMARYAAT
ELGEKNIRVNVVSGGPIETDALRAFTNYEEVKQATINLSPLNRIGQPQDLAGACLFLCSN
KASWVTGHTFVVDGGTTFK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaatacagaatttcaaggcaaaactttagtcattagcggcggaacccgcggtattggc
aaagctatagtttatgagtttgctaaagtaggggtgaatatagcctttacttataattct
aatgcacaaattgctcaagatatggtaaaagatcttcaaagaacttataagattaaggca
aaagcttatgagtttaatattttagaacctcaaacttataaagagctttttgaaaaaatt
gatatagattttgatagggtagatttttttatttcaaatgcaattatttcaggtcgtgca
gttgtgggtggttatactaaatttatgaaacttaaaccaaagggaataaataatattttc
actgctacggttaatgcttttgttgtaggcgctcaagaagcggctaaaagaatggaaaaa
ataggaggtgggagtattatttctatttcttctacaggtaatttagtttatattgaaaat
tattcaggacatggtacagcaaaagctgcagtagaagctatggcaagatatgctgcaact
gaacttggagaaaaaaatatccgtgtgaatgtagtaagtggaggacctattgaaacagat
gctttaagagcttttacaaattatgaagaagtaaaacaagctactatcaatttaagtcct
ttaaatcgcataggtcaacctcaagatttagctggagcatgtctttttttgtgttcaaat
aaggcaagttgggttacaggccatacttttgttgtagatggaggaactacttttaaatag

DBGET integrated database retrieval system