KEGG   Campylobacter hepaticus: A2J15_003675Help
Entry
A2J15_003675      CDS       T05589                                 

Definition
(GenBank) bifunctional riboflavin kinase/FAD synthetase
  KO
K11753  riboflavin kinase / FMN adenylyltransferase [EC:2.7.1.26 2.7.7.2]
Organism
chw  Campylobacter hepaticus
Pathway
chw00740  Riboflavin metabolism
chw01100  Metabolic pathways
chw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:chw00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    A2J15_003675
Enzymes [BR:chw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.26  riboflavin kinase
     A2J15_003675
   2.7.7  Nucleotidyltransferases
    2.7.7.2  FAD synthetase
     A2J15_003675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavokinase FAD_syn MerR_1 CTP_transf_like
Motif
Other DBs
NCBI-ProteinID: AXP08808
UniProt: A0A424Z1A3
Position
complement(742279..743124)
Genome map
AA seq 281 aa AA seqDB search
MLNIFTTMLKTNVSSLALGCFDGMHLGHLKLVEHLDENGILLVINKFKGKMLCSNTQKEE
ISKKKVIELDFESIKSLEGKEFLDFLKKEFIHLKLIVVGYDFSFGKNRVYKAQDIELLSK
IKTLIVDKFSIDGVAVHTSLIKDFLAKANLQKVKKFLGRNYSIKARVVKGQGLGSKELFA
TINLECKDYFLPSNGVYASILKSKNKIYKSVSFIGIRSSDDKFAIESHILEHLNEKFSLD
EVLELEFVDFIRENQKFKDLKKLKDQIAKDIHQAHSLLRGS
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atattgaatatttttactactatgttaaaaactaatgttagttctttggcattgggttgt
tttgatggtatgcatttaggacatttaaagcttgtagaacatttagatgaaaatggtatt
ttactagtgattaataaatttaaaggtaaaatgctttgttctaatacacaaaaagaagaa
atatcaaagaaaaaagttatagaattggattttgaaagtataaaatctttagagggtaaa
gaatttttagattttttaaaaaaagaatttatacatttaaaattaatagttgtaggttat
gatttttcttttggtaaaaatagggtttataaggctcaagatattgaattattaagtaaa
ataaaaactttaatagtagataaatttagcattgatggtgtagcagttcatacaagctta
attaaagattttttagctaaggcaaatttacaaaaagtaaaaaaattcttaggaagaaat
tatagtattaaagcaagggtagttaaaggacaagggcttggttctaaagaactttttgct
actattaatttagaatgtaaagattattttttaccttcaaatggagtttatgcaagtata
ttaaagagtaaaaacaaaatttacaaaagtgtaagttttataggtataagatcaagtgat
gataaatttgctatagaaagtcatattttagaacatttgaatgaaaaattttctttagat
gaggttttagaacttgaatttgttgattttattagagaaaatcaaaaatttaaagatttg
aaaaaacttaaagatcaaattgctaaggatattcatcaagcgcatagcttgttaagggga
agttaa

DBGET integrated database retrieval system