KEGG   Capra hircus (goat): 100860838Help
Entry
100860838         CDS       T02910                                 

Gene name
IGF1, IGF-1, IGF-I, IGFI, gIGFI
Definition
(RefSeq) insulin like growth factor 1
  KO
K05459  insulin-like growth factor 1
Organism
chx  Capra hircus (goat)
Pathway
chx01521  EGFR tyrosine kinase inhibitor resistance
chx01522  Endocrine resistance
chx04010  MAPK signaling pathway
chx04014  Ras signaling pathway
chx04015  Rap1 signaling pathway
chx04066  HIF-1 signaling pathway
chx04068  FoxO signaling pathway
chx04114  Oocyte meiosis
chx04115  p53 signaling pathway
chx04150  mTOR signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04152  AMPK signaling pathway
chx04211  Longevity regulating pathway
chx04213  Longevity regulating pathway - multiple species
chx04510  Focal adhesion
chx04550  Signaling pathways regulating pluripotency of stem cells
chx04730  Long-term depression
chx04750  Inflammatory mediator regulation of TRP channels
chx04913  Ovarian steroidogenesis
chx04914  Progesterone-mediated oocyte maturation
chx04935  Growth hormone synthesis, secretion and action
chx04960  Aldosterone-regulated sodium reabsorption
chx05200  Pathways in cancer
chx05202  Transcriptional misregulation in cancer
chx05205  Proteoglycans in cancer
chx05214  Glioma
chx05215  Prostate cancer
chx05218  Melanoma
chx05224  Breast cancer
chx05410  Hypertrophic cardiomyopathy (HCM)
chx05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100860838 (IGF1)
   04015 Rap1 signaling pathway
    100860838 (IGF1)
   04010 MAPK signaling pathway
    100860838 (IGF1)
   04066 HIF-1 signaling pathway
    100860838 (IGF1)
   04068 FoxO signaling pathway
    100860838 (IGF1)
   04151 PI3K-Akt signaling pathway
    100860838 (IGF1)
   04152 AMPK signaling pathway
    100860838 (IGF1)
   04150 mTOR signaling pathway
    100860838 (IGF1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100860838 (IGF1)
   04115 p53 signaling pathway
    100860838 (IGF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100860838 (IGF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100860838 (IGF1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    100860838 (IGF1)
   04914 Progesterone-mediated oocyte maturation
    100860838 (IGF1)
   04935 Growth hormone synthesis, secretion and action
    100860838 (IGF1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100860838 (IGF1)
  09156 Nervous system
   04730 Long-term depression
    100860838 (IGF1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100860838 (IGF1)
  09149 Aging
   04211 Longevity regulating pathway
    100860838 (IGF1)
   04213 Longevity regulating pathway - multiple species
    100860838 (IGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100860838 (IGF1)
   05202 Transcriptional misregulation in cancer
    100860838 (IGF1)
   05205 Proteoglycans in cancer
    100860838 (IGF1)
  09162 Cancer: specific types
   05214 Glioma
    100860838 (IGF1)
   05218 Melanoma
    100860838 (IGF1)
   05215 Prostate cancer
    100860838 (IGF1)
   05224 Breast cancer
    100860838 (IGF1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    100860838 (IGF1)
   05414 Dilated cardiomyopathy (DCM)
    100860838 (IGF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100860838 (IGF1)
   01522 Endocrine resistance
    100860838 (IGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    100860838 (IGF1)
Cytokines and growth factors [BR:chx04052]
 Growth factors
  Growth factors (RTK binding)
   100860838 (IGF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Insulin
Motif
Other DBs
NCBI-GeneID: 100860838
NCBI-ProteinID: NP_001272626
UniProt: P51457 D2DS56
Position
5
AA seq 154 aa AA seqDB search
MGKISSLPTQLFKCCFCDFLKQVKMPVTSSSHLFYLALCLLAFTSSATAGPETLCGAELV
DALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSAR
SVRAQRHTDMPKAQKEVHLKNTSRGSAGNKNYRM
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaatcagcagtcttccaacccaattatttaagtgctgcttttgtgatttcttg
aagcaggtgaagatgccagtcacatcctcctcgcatctcttctatctggccctgtgcttg
ctcgccttcaccagctctgccacggcgggacccgagaccctctgcggggctgagttggtg
gatgctctccagttcgtgtgtggagacaggggcttttatttcaacaagcccacggggtac
ggctcgagcagtcggagagcgccccagacaggaatcgtggatgagtgctgcttccggagc
tgtgatctgaggaggctggagatgtactgtgcgcctctcaagcccaccaagtcagcccgc
tcagtccgtgcccagcgccacaccgacatgcccaaggctcagaaggaagtacatttgaag
aacacaagtagagggagtgcaggaaacaagaactacagaatgtag

DBGET integrated database retrieval system