KEGG   Capra hircus (goat): 100861120
Entry
100861120         CDS       T02910                                 

Gene name
TM7SF2
Definition
(RefSeq) transmembrane 7 superfamily member 2
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
chx  Capra hircus (goat)
Pathway
chx00100  Steroid biosynthesis
chx01100  Metabolic pathways
Module
chx_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    100861120 (TM7SF2)
Enzymes [BR:chx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     100861120 (TM7SF2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 100861120
NCBI-ProteinID: XP_005699939
UniProt: A0A452DYK9
Position
29
AA seq 418 aa
MAPPQGSRAPLEFGGPLGAAALMLLLPVTMFHLLLVARSGPARLLGPPPYLPGLEELWSP
WALLLCLTWLGLQAALYLLPARKVAEGQELKDKSRLRYPINGFQALVLTALLVALGVSAG
LPLSALPEMLLPLAFAATLTAFIFSLLLYLKALVAPASALAPGGNSGNLIYDFFLGRELN
PRICSFDFKYFCELRPGLIGWVLINLALLMQEAELRGSPSLAMWLVNGFQLLYVADALWY
EEAVLTTMDIIHDGFGFMLAFGDLAWVPFTYSLQAQFLLYHPQPLGWPLASFICLINAVG
YYIFRGANSQKNTFRKNPSDPRVADLETISTATGRRLLVSGWWGMVRHPNYLGDLIMALA
WSLPCGVFHLLPYFYFLYFTALLVHREDRDERQCLQKYGLAWHEYCRRVPYRIVPYVY
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggcccctcctcagggctctcgggccccgctggaattcggaggacccttgggcgccgcg
gcgctgatgctgctgctcccggtcactatgtttcacctgctactggtggcccgctcggga
ccggcgcgccttctgggcccacccccctacctgccgggactggaggagctgtggagcccg
tgggcgctgttgctctgtctcacctggctcggcctgcaggcggcgctctacctcttgccg
gcgcgcaaggtggctgaggggcaggaattgaaggacaagagtcgactgcgctaccccatt
aacggcttccaggccctggtgctgacagccctcctggtggccctgggggtgtcagccggg
ctgcccctgagcgcgctcccggaaatgctcttgcccttggcatttgcggccaccctcacc
gccttcatcttcagcctccttctgtatctgaaggctctggtagcccctgcctcggccctg
gcacctggagggaactcaggcaatctcatctacgacttcttcctgggacgggagctcaac
ccgcgcatctgttcctttgacttcaaatatttctgcgaactgcgacctggcctcatcggc
tgggtcctcatcaacctggccttgctgatgcaggaagcagaacttcgggggagtccctca
ctggccatgtggctggtcaatggcttccagctactgtatgtggctgatgccctttggtac
gaggaggcagtcctgaccaccatggacatcatccatgacgggtttggcttcatgctggcc
tttggggacctcgcctgggtacccttcacctacagcctgcaggcccagttcctgctgtat
cacccacagcctctggggtggcccctggcctcattcatctgcctcatcaatgctgttggt
tactacatcttccgtggagccaattctcagaaaaacaccttccgaaagaatccttctgat
cccagagtggctgaccttgagaccatctctacagccacagggcgacggctgctggtgtct
gggtggtggggtatggtccgccatcccaactaccttggagacctcatcatggctctggcc
tggtccttgccgtgcggggtgttccacctgttgccctacttctacttcctctacttcact
gcgctgctggtgcaccgtgaggaccgggatgagcggcagtgtctgcagaagtacggccta
gcctggcacgaatactgccggcgtgtgccctaccgaatcgtgccctacgtctactga

DBGET integrated database retrieval system