KEGG   Capra hircus (goat): 100861228Help
Entry
100861228         CDS       T02910                                 

Gene name
TGFB2
Definition
(RefSeq) transforming growth factor beta 2
  KO
K13376  transforming growth factor beta-2
Organism
chx  Capra hircus (goat)
Pathway
chx04010  MAPK signaling pathway
chx04060  Cytokine-cytokine receptor interaction
chx04068  FoxO signaling pathway
chx04110  Cell cycle
chx04218  Cellular senescence
chx04350  TGF-beta signaling pathway
chx04380  Osteoclast differentiation
chx04390  Hippo signaling pathway
chx04933  AGE-RAGE signaling pathway in diabetic complications
chx05140  Leishmaniasis
chx05142  Chagas disease (American trypanosomiasis)
chx05144  Malaria
chx05145  Toxoplasmosis
chx05146  Amoebiasis
chx05152  Tuberculosis
chx05161  Hepatitis B
chx05166  Human T-cell leukemia virus 1 infection
chx05200  Pathways in cancer
chx05205  Proteoglycans in cancer
chx05206  MicroRNAs in cancer
chx05210  Colorectal cancer
chx05211  Renal cell carcinoma
chx05212  Pancreatic cancer
chx05220  Chronic myeloid leukemia
chx05225  Hepatocellular carcinoma
chx05226  Gastric cancer
chx05321  Inflammatory bowel disease (IBD)
chx05323  Rheumatoid arthritis
chx05410  Hypertrophic cardiomyopathy (HCM)
chx05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100861228 (TGFB2)
   04350 TGF-beta signaling pathway
    100861228 (TGFB2)
   04390 Hippo signaling pathway
    100861228 (TGFB2)
   04068 FoxO signaling pathway
    100861228 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100861228 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100861228 (TGFB2)
   04218 Cellular senescence
    100861228 (TGFB2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100861228 (TGFB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100861228 (TGFB2)
   05206 MicroRNAs in cancer
    100861228 (TGFB2)
   05205 Proteoglycans in cancer
    100861228 (TGFB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100861228 (TGFB2)
   05212 Pancreatic cancer
    100861228 (TGFB2)
   05225 Hepatocellular carcinoma
    100861228 (TGFB2)
   05226 Gastric cancer
    100861228 (TGFB2)
   05220 Chronic myeloid leukemia
    100861228 (TGFB2)
   05211 Renal cell carcinoma
    100861228 (TGFB2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100861228 (TGFB2)
   05321 Inflammatory bowel disease (IBD)
    100861228 (TGFB2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    100861228 (TGFB2)
   05414 Dilated cardiomyopathy (DCM)
    100861228 (TGFB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100861228 (TGFB2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100861228 (TGFB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100861228 (TGFB2)
   05161 Hepatitis B
    100861228 (TGFB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100861228 (TGFB2)
   05144 Malaria
    100861228 (TGFB2)
   05145 Toxoplasmosis
    100861228 (TGFB2)
   05140 Leishmaniasis
    100861228 (TGFB2)
   05142 Chagas disease (American trypanosomiasis)
    100861228 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    100861228 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:chx00536]
    100861228 (TGFB2)
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100861228 (TGFB2)
Glycosaminoglycan binding proteins [BR:chx00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   100861228 (TGFB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Motif
Other DBs
NCBI-GeneID: 100861228
NCBI-ProteinID: XP_017915648
UniProt: A0A452FPM4
Position
16
AA seq 442 aa AA seqDB search
MHYCVLSAFLLLHLVTVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
EEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPSFLPSETVCPV
VTTPSGSVGSLCSRQSQVFCGYLDAIPPTFYRPYFRIVRFDVSSMEKNASNLVKAEFRVF
RLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLH
HKDRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARFAGIDGTSTYTSGDQKTIKSTRK
KNSGKSPHLLLMLLPSYRLESQQSNRRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGW
KWIHEPKGYNANFCAGACPYLWSADTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILY
YIGKTPKIEQLSNMIVKSCKCS
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgcactactgtgtgttgagcgcgtttctgctcctgcatctggtcacggtcgcgctcagc
ctgtctacctgcagcacgctcgacatggaccagttcatgcgcaagaggatcgaggcgatc
cgcgggcagatcctgagcaagctgaagctcaccagccccccagaagactaccccgaaccc
gaggaggtccccccggaggtgatctccatctacaacagcaccagggacttgctccaggag
aaggcgagccggagggcggccgcctgcgagcgcgagcggagcgacgaggaatactacgcc
aaggaggtttacaaaatagacatgccgtccttcttaccctcggaaactgtctgcccagtt
gttacaacaccctctggctcagtgggcagcttgtgctccagacagtcccaggttttctgt
gggtaccttgatgccatcccgcccactttctacagaccatactttagaattgttcgattt
gacgtctcctcgatggagaagaatgcttccaatttggtgaaggccgagttcagagtcttt
cgtttacagaacccgaaagccagagtgcctgaacaacggatcgagctgtatcagattctc
aaatccaaagatttaacatctccaacccagcgctacatcgacagcaaagttgtgaaaacc
agagcagagggcgaatggctctcctttgatgtcaccgatgctgttcacgaatggctccac
cataaagacaggaacctgggatttaaaataagtttacactgtccctgctgcacctttgta
ccatcgaataattacatcatccccaataaaagtgaagaactagaagcacgatttgcaggt
attgatggcacctctacctataccagtggtgatcagaaaacaataaagtccactaggaaa
aaaaacagtgggaagagcccacatctcctgctaatgttgttgccctcctacagacttgag
tcgcaacagtccaaccggcggaagaagcgtgctctggacgcagcctattgctttagaaat
gtgcaggataattgttgcctacgcccactttacattgatttcaagagggatctcgggtgg
aaatggattcatgagcctaaagggtacaatgccaacttctgtgctggagcatgcccgtat
ctgtggagcgcagacactcagcacagtagggttctcagcttatataataccataaatcca
gaagcgtctgcttccccttgctgcgtgtcccaagatttagagccgctcaccattctctac
tacattggcaaaacacccaagatcgaacagctttctaatatgattgtcaagtcttgcaaa
tgcagctaa

DBGET integrated database retrieval system