KEGG   Capra hircus (goat): 100861230
Entry
100861230         CDS       T02910                                 

Gene name
GH1, GH, GH-4, GH-5, GH4, GH5
Definition
(RefSeq) growth hormone 1
  KO
K05438  growth hormone
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04080  Neuroactive ligand-receptor interaction
chx04151  PI3K-Akt signaling pathway
chx04630  Jak-STAT signaling pathway
chx04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    100861230 (GH1)
   04151 PI3K-Akt signaling pathway
    100861230 (GH1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100861230 (GH1)
   04060 Cytokine-cytokine receptor interaction
    100861230 (GH1)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    100861230 (GH1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    100861230 (GH1)
Cytokines and growth factors [BR:chx04052]
 Cytokines
  CSF and other factors
   100861230 (GH1)
SSDB
Motif
Pfam: Hormone_1 XTBD
Other DBs
NCBI-GeneID: 100861230
NCBI-ProteinID: NP_001272515
UniProt: P67931 Q19AP0
Position
19
AA seq 217 aa
MMAAGPRTSLLLAFTLLCLPWTQVVGAFPAMSLSGLFANAVLRAQHLHQLAADTFKEFER
TYIPEGQRYSIQNTQVAFCFSETIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLS
RVFTNSLVFGTSDRVYEKLKDLEEGILALMRELEDVTPRAGQILKQTYDKFDTNMRSDDA
LLKNYGLLSCFRKDLHKTETYLRVMKCRRFGEASCAF
NT seq 654 nt   +upstreamnt  +downstreamnt
atgatggctgcaggcccccggacctccctgctcctggctttcaccctgctctgcctgccc
tggactcaggtggtgggcgccttcccagccatgtccttgtccggcctgtttgccaacgct
gtgctccgggctcagcacctgcatcaactggctgctgacaccttcaaagagtttgagcgc
acctacatcccggagggacagagatactccatccagaacacccaggttgccttctgcttc
tccgaaaccatcccggcccccacgggcaagaatgaggcccagcagaaatcagacttggag
ctgcttcgcatctcactgctccttatccagtcgtggcttgggcccctgcagttcctcagc
agagtcttcaccaacagcctggtgtttggcacctcggaccgtgtctatgagaagctgaag
gacctggaggaaggcatcctggccctgatgcgggagctggaagatgttaccccccgggct
gggcagatcctcaagcagacctatgacaaatttgacacaaacatgcgcagtgacgacgcg
ctgctcaagaactacggtctgctctcctgcttccggaaggacctgcacaagacggagacg
tacctgagggtcatgaagtgtcgccgcttcggggaggccagctgcgccttctag

DBGET integrated database retrieval system