KEGG   Capra hircus (goat): 102168201Help
Entry
102168201         CDS       T02910                                 

Gene name
SPHK1
Definition
(RefSeq) sphingosine kinase 1
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
chx  Capra hircus (goat)
Pathway
chx00600  Sphingolipid metabolism
chx01100  Metabolic pathways
chx04020  Calcium signaling pathway
chx04071  Sphingolipid signaling pathway
chx04072  Phospholipase D signaling pathway
chx04370  VEGF signaling pathway
chx04371  Apelin signaling pathway
chx04666  Fc gamma R-mediated phagocytosis
chx05152  Tuberculosis
Module
chx_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    102168201 (SPHK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    102168201 (SPHK1)
   04371 Apelin signaling pathway
    102168201 (SPHK1)
   04020 Calcium signaling pathway
    102168201 (SPHK1)
   04072 Phospholipase D signaling pathway
    102168201 (SPHK1)
   04071 Sphingolipid signaling pathway
    102168201 (SPHK1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    102168201 (SPHK1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102168201 (SPHK1)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     102168201 (SPHK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 102168201
NCBI-ProteinID: XP_017919236
Position
19
AA seq 484 aa AA seqDB search
MPVRATPRAWSQNLTGRPPPQGTAPDSTSAVSSPSDPATAGNDAGGEGEPHSRHREARLG
STDKELKSGAAAADSVRTVPGTPRQRGPGGEVMDAAGGSRNPLPRPCHVLVLLNPRGGKG
KALQLFWSHVQPLLAQADVSFTLMLTERRNHARELVRAEDLRRWDALVVMSGDGLIHEVV
NGLMERPDWETAIQKPLCSLPAGSGNAMAASLNYYAGYEQVTKEDLLTNCTQLLCRRLLA
PMDLLSLQTACGQRLFSVLSLAWGFIADVDLESEKFRRLGEIRFTLGTCLRLVALRTYRG
TLAYLPAETLASRRGPSPARAPQAPSDTHVAPLEQPVPPHWTVVPEQDFVLVLALLHSHL
ASELFTAPMGRCSAGAMHLFYVRAGVSRATLLRLFLAMEKGRHMECHCPHLVYVPVVAFR
LEPKDGKGVFAVDGELLISEAVQGQVLPNYFWMVSGYRESPPSLKPQSSPRRKSQQRPPP
AESR
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgccggtgcgcgcgactcccagagcgtggtcccagaacctaacggggcgccccccacct
caggggaccgctccagactccaccagcgcggtttcctctccctcagatccggcaaccgca
gggaatgacgcgggcggggagggcgagccccacagccgtcaccgagaggcccgcctgggc
agcaccgataaggagctgaagtcaggagccgccgcggcggacagcgtccggacagtgccg
gggacccctcggcagcgggggccagggggcgaggtcatggatgcagcgggcggctcccgg
aacccgctcccaaggccctgccacgtgctggtgctgttaaatccgcgcgggggcaagggc
aaagccctgcagctcttctggagccacgtgcagccgctgctggcccaggccgacgtctcc
ttcacgctgatgctcactgagcggcggaaccacgcccgggagctggtgcgcgccgaggac
ctgagacgctgggacgcgctggtggtcatgtccggagacggactgatccatgaggtggtg
aacgggctcatggagcggcctgactgggagaccgccatccagaagcccctgtgtagcctc
ccggccggctctggcaatgcgatggccgcttctttgaactattacgccgggtatgagcag
gtgactaaggaagacctcctgaccaactgcacgcagctgctgtgccgccggctgctggcg
cccatggacctgctatccctgcagaccgcctgcgggcagcgcctcttctccgtgctcagc
ctggcatggggtttcatcgccgacgtggatctggagagcgagaagtttcggcgcctgggg
gagatccgcttcactctcggcacctgcctgcgcctggtggccctgcgcacctaccggggc
accctggcctacctgcccgcagaaacgctggcctccaggaggggcccctccccggctcgg
gccccgcaggccccctcggacacccacgtggcgcccctggagcagccagtgcctcctcac
tggacggtggtgccggagcaggacttcgtgctggtgttggcactcctgcactcccacctg
gccagtgagcttttcaccgcccccatgggccgctgttcagccggcgccatgcatctgttc
tacgtgcgcgccggcgtgtcccgggccacgctgctgcgcctcttcctggccatggagaaa
ggcaggcacatggagtgccactgcccccacctggtgtatgtgcccgtggttgccttccgc
ctggagcccaaggatgggaagggtgtgtttgctgtggatggggaactgctaatcagtgag
gctgtccagggccaggttctccccaactacttctggatggtcagtggctacagggagtcc
ccaccctctctgaaaccgcagtcctcaccccgcaggaagtctcagcagaggccgccccca
gcagagagccggtga

DBGET integrated database retrieval system