KEGG   Capra hircus (goat): 102168996Help
Entry
102168996         CDS       T02910                                 

Gene name
INSR
Definition
(RefSeq) insulin receptor
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
chx  Capra hircus (goat)
Pathway
chx04010  MAPK signaling pathway
chx04014  Ras signaling pathway
chx04015  Rap1 signaling pathway
chx04022  cGMP-PKG signaling pathway
chx04066  HIF-1 signaling pathway
chx04068  FoxO signaling pathway
chx04072  Phospholipase D signaling pathway
chx04150  mTOR signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04152  AMPK signaling pathway
chx04211  Longevity regulating pathway
chx04213  Longevity regulating pathway - multiple species
chx04520  Adherens junction
chx04910  Insulin signaling pathway
chx04913  Ovarian steroidogenesis
chx04923  Regulation of lipolysis in adipocytes
chx04930  Type II diabetes mellitus
chx04931  Insulin resistance
chx04932  Non-alcoholic fatty liver disease (NAFLD)
chx04960  Aldosterone-regulated sodium reabsorption
Module
chx_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102168996 (INSR)
   04015 Rap1 signaling pathway
    102168996 (INSR)
   04010 MAPK signaling pathway
    102168996 (INSR)
   04066 HIF-1 signaling pathway
    102168996 (INSR)
   04068 FoxO signaling pathway
    102168996 (INSR)
   04072 Phospholipase D signaling pathway
    102168996 (INSR)
   04022 cGMP - PKG signaling pathway
    102168996 (INSR)
   04151 PI3K-Akt signaling pathway
    102168996 (INSR)
   04152 AMPK signaling pathway
    102168996 (INSR)
   04150 mTOR signaling pathway
    102168996 (INSR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102168996 (INSR)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102168996 (INSR)
   04923 Regulation of lipolysis in adipocyte
    102168996 (INSR)
   04913 Ovarian Steroidogenesis
    102168996 (INSR)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102168996 (INSR)
  09149 Aging
   04211 Longevity regulating pathway - mammal
    102168996 (INSR)
   04213 Longevity regulating pathway - multiple species
    102168996 (INSR)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    102168996 (INSR)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102168996 (INSR)
   04931 Insulin resistance
    102168996 (INSR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    102168996 (INSR)
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:chx04090]
    102168996 (INSR)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102168996 (INSR)
Protein kinases [BR:chx01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   102168996 (INSR)
CD molecules [BR:chx04090]
 Proteins
  102168996 (INSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain Pkinase Furin-like fn3 Kinase-like B2 DUF4476
Motif
Other DBs
NCBI-GeneID: 102168996
NCBI-ProteinID: XP_017906623
Position
7
AA seq 1382 aa AA seqDB search
MGAGGGRGAAAVLLMVVVAALLVGAAGHLYPGEVCPGMDIRNNLTRLHELANCSVIEGHL
QILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYAL
VIFEMVHLKELGLYSLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNE
ECGDICPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHGCTSEGLCCHSECL
GNCSEPNDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRCVNFSFCQDLHNKCKNSRRQG
CHQYVIHNNKCVPECPSGYTMNSSNLMCTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGC
TIINGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGETL
EIGNYSFYALDNQNLRQLWDWGKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQE
RNDIALKTNGDQASCENELLKFSYIRTSYDKILLKWEPYWPPDFRDLLGFMLFYKEAPYQ
NVTEFDGQDACGSNSWTVVDIDPPTRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFS
DERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWE
RQAEDSELYELDYCLKGLKLPSRTWSPPFESEGSQKHNQSEYEESAGECCSCPKTDSQIL
KELEESSFRKTFEDYLHNVVFIPRKSSSGPVAEDARPSRKRRALGDVGNVTAAVPTVLGF
PNSSSTSTPTSSEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDSPEERCSVAAYV
SARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGEEELHLCV
SRRHYALERGCRLRGLLPGNYSVRVRATSLAGNGSWTEATYFYVTDYLDVPSNIAKIIIG
PLIFVFLFSVVIGSICLFLRKRQPDGPLGPLYASSNPEYLSASDVFPCSVYVPDEWEVPR
EKITLLRELGQGSFGMVYEGNARDIVKGEAETRVAVKTVNESASLRERIEFLNEASVMKG
FTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMA
AEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPV
RWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDN
CPERVTDLMRMCWQFNPKMRPTFLEIVDLLKDDLHPSFPEVSFFHSEENKAPESEELEME
FEDMESVPLDRSSHAQREEAGVRDGGSALGLKRNYDEHIPYTHMNGGKKNGRILTLPRSN
PS
NT seq 4149 nt NT seq  +upstreamnt  +downstreamnt
atgggcgccgggggcgggaggggggcggcagccgtgctgctgatggtggtcgtcgccgcg
ctgctggtgggcgccgcgggccacctgtaccctggagaagtgtgccccggtatggatatc
cggaataatctcacccggctgcatgagctggccaactgctcggtcattgaaggacatttg
cagattctgttgatgttcaaaacgagacctgaggacttccgagacctcagtttccccaaa
ctcatcatgatcactgattacttgctgctcttccgggtctatgggctggagagcctgaag
gacttgttccccaacctcacggtcatccgaggctcgcgcctcttctttaattatgcactg
gtcatctttgagatggttcacctgaaggagcttggcctctacagcctgatgaacatcacc
cgggggtctgtccgcatcgagaagaacaatgaactctgctacctggccaccatcgactgg
tctcgcatcctggattccgtggaggataattacatcgtgctaaacaaagacgacaatgag
gagtgtggggacatttgtccaggcaccgccaagggcaagaccaactgccctgccactgtc
atcaacgggcagtttgtggagcggtgctggacacacagccactgccagaaagtgtgtccg
actatctgtaagtcacatggctgcacctctgagggtctctgctgccacagcgagtgcttg
ggcaactgctcagagcccaacgaccccaccaagtgcgtggcctgtcgcaacttctacctg
gacggcaggtgcgtggagacctgcccgcccccttactaccacttccaagactggcgctgc
gtgaacttcagcttctgccaggacctgcacaacaaatgcaagaactctcggaggcaaggc
tgccaccagtatgtcattcacaacaacaagtgcgtccccgagtgcccctctggctacacg
atgaattctagcaacttgatgtgtaccccttgcctgggcccctgtcccaaggtatgccac
ctcctggaaggtgagaagaccatcgattcagtaacatctgcccaggagctccgaggctgc
accatcatcaacggaagcttaatcatcaacattcgagggggcaacaacctggcagctgag
ctagaggccaaccttggactcattgaggaaatttcaggatatctgaaaatccgccggtcc
tatgccctggtgtcactttccttcttccggaagttacgtctgattcgaggggagaccttg
gaaattgggaactactctttctacgccttggacaaccagaacctaaggcagctatgggac
tggggcaaacacaacctcaccatcactcaggggaaactcttcttccactataaccccaaa
ctgtgcctgtcggaaattcacaagatggaggaagtttcaggaacgaaggggcgccaggag
agaaatgacattgctttaaagaccaatggggaccaggcatcctgtgaaaatgaattactt
aaattttcttacattcggacatcttatgacaagatcttgctgaaatgggagccgtattgg
cctcctgacttccgagacctcctggggttcatgttgttctacaaagaggccccttaccag
aatgtgacagaattcgatgggcaggatgcgtgcggctccaacagctggacagtggtggat
attgacccacctacgaggtccaacgaccccaagtcacagaaccatcctgggtggctgatg
cgtggtctcaagccctggacccagtatgccatctttgtcaagaccctggtcaccttttct
gatgaacgccgtacatacggagccaagagtgacatcatctatgtccagacagatgccact
aatccttccgtccccctggatcccatctcagtttctaattcctcgtcccagattattctg
aagtggaagcctccctccgaccccaacggcaatatcacacactacttggtgttctgggag
aggcaggcggaagacagtgagctgtatgaactggattattgcctcaaagggttgaagctg
ccctcccggacctggtctccaccattcgagtcggaggggtctcagaagcacaaccagagt
gagtatgaggagtctgctggcgaatgctgctcctgcccgaagaccgactctcagatcctc
aaggagctggaggagtcctcgttcaggaaaacatttgaagattacctgcacaacgtggtt
ttcatccccagaaaatcatcttcaggccctgttgccgaggacgctaggccttcgaggaaa
cgcagagcccttggtgacgtggggaatgtgacagcagccgtgcccactgttctggggttc
cccaatagctcctccaccagcacacccacgagctcagaggagcacagacccttcgagaaa
gtggtgaacaaggagtcgctggtcatctccggcctgcgtcactttactgggtatcgcatc
gagcttcaggcttgcaaccaagattcccccgaggagaggtgtagcgtggctgcctatgtc
agcgccaggaccatgcctgaagccaaggcagatgatattgtcggccccgtgacccatgaa
atcttcgagaacaacgtcgttcacttgatgtggcaggagcccaaggaacccaacggtctg
attgtgctgtatgaagtgagttaccgacgatacggcgaggaggagctgcacctctgcgtc
tcccgccggcattatgctctggagcgcggctgccggctgcgcgggctgctgcctgggaat
tacagtgtgcgagttcgggccacctccctggcaggcaatgggtcttggacggaagccacc
tacttctatgtgacagactatttagacgtgccatcaaatattgcaaaaatcatcatcggt
cccctcatctttgtctttctcttcagtgttgtgattggaagtatttgtctattcctgaga
aagaggcagccagatgggccactgggaccattgtatgcttcttcaaacccagagtacctc
agtgccagcgatgtgttcccatgctctgtgtatgtgccggacgagtgggaggtgcctcga
gagaagatcacgctcctgcgagaactgggtcaaggctccttcggcatggtgtacgagggc
aacgccagggacattgtcaagggtgaggcggagacccgcgtggcagtgaagacggtcaac
gagtcggccagcctgcgagagcggatcgagtttctcaacgaggcttcggtcatgaagggc
ttcacctgccaccatgtggtccgcctcctgggggtggtgtccaaaggccagccaacgctg
gtggtgatggagttgatggctcacggagacctgaagagttacctccgttccctgcggcct
gaggctgagaacaaccccggccgccctccccctaccctgcaagaaatgattcagatggcg
gcagagatcgccgatgggatggcatacctgaacgctaagaagttcgtgcaccgggatctt
gcagcccggaactgcatggttgcccacgactttaccgtcaaaattggagacttcggaatg
acaagagacatctatgaaacggattactaccggaaagggggcaaaggtctgctccccgtg
cggtggatggcacctgaatccctcaaggacggagtcttcaccacctcttcggacatgtgg
tcttttggtgtggtcctttgggaaattaccagcttggcagaacagccttaccaaggtcta
tcaaatgagcaggtgctgaaatttgtcatggatggagggtacctggatcaacctgacaat
tgtccagagagagtcaccgacctgatgcggatgtgctggcagttcaaccccaagatgcgt
ccgaccttcctggagatcgtggacctgctcaaggatgacctgcaccccagctttcccgaa
gtgtccttcttccacagcgaggagaacaaggcacccgagagcgaggagctggaaatggag
tttgaggacatggagagcgtgcccctggaccggtcctcgcacgcgcagagagaggaggcc
ggggtccgggacggagggtcggcgctggggctaaagcgaaactatgacgagcacatcccc
tacacccacatgaacgggggcaagaaaaacggacggattctgactttgccccggtcaaat
ccttcctaa

DBGET integrated database retrieval system