KEGG   Capra hircus (goat): 102173295Help
Entry
102173295         CDS       T02910                                 

Gene name
CTSB
Definition
(RefSeq) cathepsin B
  KO
K01363  cathepsin B [EC:3.4.22.1]
Organism
chx  Capra hircus (goat)
Pathway
chx04140  Autophagy - animal
chx04142  Lysosome
chx04210  Apoptosis
chx04612  Antigen processing and presentation
chx04621  NOD-like receptor signaling pathway
chx04924  Renin secretion
Brite
KEGG Orthology (KO) [BR:chx00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    102173295 (CTSB)
   04140 Autophagy - animal
    102173295 (CTSB)
  09143 Cell growth and death
   04210 Apoptosis
    102173295 (CTSB)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102173295 (CTSB)
   04612 Antigen processing and presentation
    102173295 (CTSB)
  09152 Endocrine system
   04924 Renin secretion
    102173295 (CTSB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:chx01002]
    102173295 (CTSB)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:chx03110]
    102173295 (CTSB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chx04147]
    102173295 (CTSB)
   00536 Glycosaminoglycan binding proteins [BR:chx00536]
    102173295 (CTSB)
Enzymes [BR:chx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.1  cathepsin B
     102173295 (CTSB)
Peptidases and inhibitors [BR:chx01002]
 Cysteine peptidases
  Family C1: papain family
   102173295 (CTSB)
Chaperones and folding catalysts [BR:chx03110]
 Intramolecular chaperones
  Papain family
   102173295 (CTSB)
Exosome [BR:chx04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   102173295 (CTSB)
Glycosaminoglycan binding proteins [BR:chx00536]
 Heparan sulfate / Haparin
  Others
   102173295 (CTSB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1 Propeptide_C1 Peptidase_C1_2
Motif
Other DBs
NCBI-GeneID: 102173295
NCBI-ProteinID: NP_001301174
UniProt: H9B8T9
Position
8
AA seq 335 aa AA seqDB search
MWQLLATLSCLLVLTSARSSLHFPPLSDEMVNYVNKQNTTWKAGHNFYNVDLSYVKKLCG
AILGGPKLPQRDAFAADMVLPDSFDAREQWPNCPTIKEIRDQGSCGSCWAFGAVEAISDR
ICIHSKGRVNVEVSAEDMLTCCGSECGDGCNGGFPSGAWNFWTKKGLVSGGLYDSHVGCR
PYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPSYKDDKHFGCSSYSVSSNEKEIM
AEIYKNGPVEGAFSVYSDFLLYKSGVYQHVSGEMMGGHAIRILGWGVENDTPYWLVGNSW
NTDWGDKGFFKILRGQDHCGIESEIVAGMPCTHQY
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgtggcagctcttggccaccctcagttgcctgctggtgctgaccagtgcccggagcagc
ctgcatttcccacctctgtctgatgagatggtcaactatgttaacaagcaaaacaccact
tggaaggctggacacaacttctacaacgtggacctgagctacgtgaagaagctgtgtggt
gccatcctgggtgggcccaagctgccccagagagacgcatttgctgcagatatggttctg
cctgacagcttcgatgcccgggaacagtggccaaactgcccaaccatcaaagagatcaga
gaccagggatcctgtggctcctgctgggcgttcggggctgtggaagccatttctgaccgg
atctgcatccacagcaaggggcgtgtcaacgtggaggtgtctgctgaggacatgctgacc
tgctgtggcagcgagtgtggggacggctgtaacggtggcttcccctctggagcctggaac
ttctggacaaagaaaggcttagtgtccgggggcctctatgactcgcatgtaggttgcaga
ccgtactccatccctccctgtgagcaccatgtgaacggctcccggcccccgtgcaccggt
gagggggacacccccaagtgcagcaagatctgtgagcctggctacagcccgtcctacaaa
gacgacaagcattttggatgcagttcctacagcgtctccagcaacgagaaggagatcatg
gcagagatctacaaaaatggcccagtcgagggggccttctctgtgtactcggacttcctg
ctatacaagtctggggtgtaccagcacgtctccggagagatgatgggaggccacgccatc
cgcatcctaggctggggagtggagaacgacaccccctactggctggtcggcaactcctgg
aacactgattggggtgacaaaggctttttcaaaatcctcagaggacaggaccactgtgga
atcgagtcggaaattgtggctggaatgccgtgcactcatcagtactag

DBGET integrated database retrieval system