KEGG   Capra hircus (goat): 102173497Help
Entry
102173497         CDS       T02910                                 

Gene name
CPT1C
Definition
(RefSeq) carnitine palmitoyltransferase 1C
  KO
K19524  carnitine O-palmitoyltransferase 1, brain isoform [EC:2.3.1.21]
Organism
chx  Capra hircus (goat)
Pathway
chx00071  Fatty acid degradation
chx01212  Fatty acid metabolism
chx03320  PPAR signaling pathway
chx04152  AMPK signaling pathway
chx04714  Thermogenesis
chx04920  Adipocytokine signaling pathway
chx04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102173497 (CPT1C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    102173497 (CPT1C)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    102173497 (CPT1C)
   04920 Adipocytokine signaling pathway
    102173497 (CPT1C)
   03320 PPAR signaling pathway
    102173497 (CPT1C)
  09159 Environmental adaptation
   04714 Thermogenesis
    102173497 (CPT1C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:chx03029]
    102173497 (CPT1C)
Enzymes [BR:chx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     102173497 (CPT1C)
Mitochondrial biogenesis [BR:chx03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    102173497 (CPT1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 102173497
NCBI-ProteinID: XP_017918291
Position
18
AA seq 779 aa AA seqDB search
MAEAHQAVGFRPSLTSDAGEVELGAPVLHEICLSGLRSWKRHLSRFWNDFLTGVFPASPL
SWLFLFSAIQLACFLQLDPSLGLMEKIKESLPDWGGQHHRLRGVLAAALFASCLWGTLIF
TLHVALRLLLSYHGWLLEPHGAMSSPTKTWLALVRIFSGRHPMLFSYQRSLPRQPVPSVQ
DTVRKYLESVRPVLSDKDFDWTSGVAQEFLKLQASLLQWYLQLKSWWASNYVSDWWEEFV
YLRSRNSLMVNSNYYLMDFLYVTPTPVQAARAGNAVHALLLYRHRLDRQEILPTLLMGMR
PLCSAQYEKIFNTTRIPGVHRDHIRHLRDSRHVAVFHRGRFFRVGTHSQSRLLSPRALEQ
QFQRILDDPSPACPHEEHLAALTAAPRDTWAQVRRSLKTQAQEALEAVEGAAFFVSLDSE
PAGLTREDPAASLDAYAHALLAGRGHDRWFDKSFSLIVFSNGKLGLSVEHSWADCPISGH
MWEFTLATECFQLGYSADGHCKGHPDPSLPQPQRLHWDLPDKIHLSISLALRAAKTLSGN
IECHVFPFSRFGKSFIKRCHLSSDSFIQTTLQLAHFRDRGQFCLTYESTMTRLFLEGRTE
TVRSCTREACNFVRAMEDKEKTDAQCLALFRLAVDKHQALLKAAMSGQGVDRHLFALYVV
SQFLHLQSPFLDQVHSEQWQLVTSQIPVQQIHLFDVHNYPDYVSSGGGFGPADDHGYGVS
YMFMGDDVITFHISSNKSSTRTDSHRLGQRIQDALLDVAALFPEGERLKRRGLGEEDSG
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagctcaccaggcggtgggcttccgaccctcactgacttcggacgcgggggaa
gtggagctcggtgccccggtgttgcatgagatctgcctctccggactgcgctcttggaaa
aggcatctctcccgtttctggaacgactttctcacaggcgtgttccctgctagccccctc
agctggcttttcctcttcagtgcaattcaacttgcctgcttcctccagctagatccttcc
ttaggactgatggagaagatcaaagagtctctgccagactggggtggacagcatcacagg
ctgcggggggtcctggcggccgcgctgtttgcgtcctgtctgtggggaactctgatcttc
acccttcatgtggccctgaggctacttctgtcctaccacggctggctcctcgaaccccac
ggagccatgtcctcgcccaccaagacctggctggccctggtgcgcatcttctccggccgc
catccaatgctcttcagttaccagcgctctctgccgcgccagcctgtgccctccgtccag
gacaccgtgcgcaagtatctggagtctgtccgacccgtcctctccgacaaggacttcgac
tggacctcgggcgtagcgcaggaattcctgaagctgcaggcctcactgctgcagtggtac
ttgcagctcaagtcctggtgggcgtccaattacgtcagtgactggtgggaagaatttgta
tacctgcgatccaggaactcactgatggtgaacagcaactattacctgatggacttcctg
tacgtcacgcccactcctgtgcaggcagcgcgtgcgggcaacgcagtccatgccctcctt
ctgtaccgccaccgcctggaccgccaggagatcctgccaactttgctgatgggaatgcga
cccttgtgctccgcccagtatgagaagatattcaacaccacgcgaattcccggggtccac
agagatcacattcgccacctccgtgacagccgacacgtggccgtcttccaccggggccgg
ttcttccgcgtggggactcactcacaaagccgcctgctttccccgcgggccctggagcag
cagtttcaacgaatcctggacgacccctctcccgcctgcccccacgaggagcatctggcg
gccttgaccgctgctccgagggacacgtgggcccaggtgcggaggtctctgaagacgcag
gcccaagaggccctggaagccgtcgaaggggccgctttcttcgtatcactggactctgag
cccgcggggctcaccagggaggaccccgcggcttccttagatgcctacgcacacgccctg
ctggccggccggggccacgaccgctggtttgacaaatctttctccctaatcgtcttctcc
aatgggaagctgggcctcagcgtggagcactcgtgggctgactgccccatctcaggacac
atgtgggagttcactctggccacagaatgctttcagctgggctactcagcagacggtcac
tgcaaggggcaccctgacccctcgctgccccagccccagaggctgcactgggaccttcca
gacaagatccatctatccatctctctagccctgagggcagccaagaccttgtctggaaac
atcgaatgccacgtcttccccttctcccgctttggcaagagtttcatcaaacgctgccat
ctctcttcagacagcttcatccagaccaccttgcagctggcccacttccgggaccggggt
caattctgcctgacttatgaatccaccatgactcgcttgttcctggaaggccgcacagag
acggtgcgttcttgcacaagggaggcctgcaactttgtgagagccatggaggacaaagag
aagacagacgcacagtgcctcgccctgtttcgcctggcggtggataagcaccaagctctg
ctgaaggcagcgatgagtggacagggggtcgatcgccacctctttgctctctatgtcgtg
tcgcagttcctccacctgcagtctccattcctggaccaggttcactcggagcagtggcag
ctggtcaccagccagattcctgttcagcaaattcacctgttcgacgttcacaattacccc
gactatgtctcctctggtggtggattcgggcctgccgatgaccatggttacggtgtgtcc
tacatgttcatgggcgatgacgtgatcaccttccacatctcgagcaacaaatcaagcaca
agaacggactcccaccggctgggccagcgcatccaggacgccttgttggacgtggccgcc
ctcttcccggagggggagcgtcttaagcgcagagggttaggggaggaagactcgggttag

DBGET integrated database retrieval system