KEGG   Capra hircus (goat): 102173552Help
Entry
102173552         CDS       T02910                                 

Gene name
UGT2B4
Definition
(RefSeq) UDP-glucuronosyltransferase 2B4
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
chx  Capra hircus (goat)
Pathway
chx00040  Pentose and glucuronate interconversions
chx00053  Ascorbate and aldarate metabolism
chx00140  Steroid hormone biosynthesis
chx00830  Retinol metabolism
chx00860  Porphyrin and chlorophyll metabolism
chx00980  Metabolism of xenobiotics by cytochrome P450
chx00982  Drug metabolism - cytochrome P450
chx00983  Drug metabolism - other enzymes
chx01100  Metabolic pathways
chx05204  Chemical carcinogenesis
Module
chx_M00014  Glucuronate pathway (uronate pathway)
chx_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:chx00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102173552 (UGT2B4)
   00053 Ascorbate and aldarate metabolism
    102173552 (UGT2B4)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    102173552 (UGT2B4)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102173552 (UGT2B4)
   00860 Porphyrin and chlorophyll metabolism
    102173552 (UGT2B4)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102173552 (UGT2B4)
   00982 Drug metabolism - cytochrome P450
    102173552 (UGT2B4)
   00983 Drug metabolism - other enzymes
    102173552 (UGT2B4)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    102173552 (UGT2B4)
Enzymes [BR:chx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     102173552 (UGT2B4)
Glycosyltransferases [BR:chx01003]
 Others
  Hydrophobic molecule
   102173552 (UGT2B4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Adeno_E3_CR2
Motif
Other DBs
NCBI-GeneID: 102173552
NCBI-ProteinID: XP_005701737
Position
6
AA seq 535 aa AA seqDB search
MSKMSMKWLSLLLLLQLTCYFSSGSCGKVLVWPVEFSHWMNMKAVLDELVMRGHEVTVLI
SSASTITDANKPSAFKFEIFPVSLTKDDFENAVKNLIEKWTYMGKNSFWTNVSSLRELKS
LLWEFSGMLMKMCKEVVSKKKLITKLQESRFDVLLADAAGPCGELLTEILRIPLVYSLRF
SPGFLFEKYSGQLSFPPSYVPVIFSALSDDMTFMERVKNMIYVLYFDFWFQTFDEKTWNE
FYSEVLGRPTTFLETVGKADMWLIRTYWDFEFPRPVLPNFEFVGGLHCKPAKPLPKEMEE
FVQSSGENGIVVFTLGSMISNITEEKVNVIASALAQIPQKVLWRYDGKKPDTLGPNTRLY
KWIPQNDLLGHPKTKAFITHGGTNGIYEAIHHGIPMVGLPLFADQPDNIARVKAKGAAVR
VDLETMSARDLLNALKEVINNPSYKEKAMWLSTIQHDQPIKPLDRAIFWIEFVMRHKGAK
HLRPAAHNLTWFQYHSLDVIGFLLACVATVVFVITKCFLFCYRKFAKTGKKQKRE
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagatgtctatgaaatggctctcacttctgctgctgctacagctgacttgctac
tttagctctgggagttgtggaaaggtgctggtgtggccagtggaatttagtcattggatg
aatatgaaggcagttctggatgaactagtcatgaggggtcatgaggtgactgttctaata
tcttcagcttccactattactgatgccaacaaaccatctgcttttaagtttgagattttc
cctgtatctttaactaaagatgattttgagaatgctgtcaagaatttgattgagaaatgg
acatacatgggaaaaaattcattttggacaaatgtttcatcattgagagaattgaaaagc
ttactttgggaattttctggaatgcttatgaaaatgtgtaaagaagttgtttcaaaaaag
aaacttataacaaaactacaggaatcaaggtttgatgtccttcttgcagatgctgctgga
ccctgtggtgagctgctgactgagatacttagaatacctttagtatacagtctccgtttc
tcgcctggctttttgtttgaaaagtatagtggacaactttcatttccaccatcctatgta
cctgttatattttcagcattaagtgatgacatgacattcatggaaagggtcaaaaatatg
atatatgtactttattttgacttctggttccaaacatttgatgagaagacatggaacgag
ttttacagtgaagtactgggaagacccactacatttttagagacagttggaaaagctgat
atgtggctcattcgaacctactgggactttgaatttcctcgcccagtgttgccaaatttt
gaatttgttggaggcctccactgcaaacctgccaaacccctgcctaaggaaatggaagag
tttgttcagagctctggagaaaatggtattgtggtgtttactttggggtcaatgatcagt
aacataacagaagaaaaagtcaatgtaattgcatcagctcttgcccagattccacaaaaa
gttctatggagatatgatggcaagaaaccggataccttggggcccaatacccgtctgtat
aagtggatcccccaaaacgaccttcttggtcacccaaaaaccaaagcctttataactcat
ggtggaaccaatggcatttatgaggccatccatcatgggatccctatggtgggccttcct
ttgtttgctgatcaacctgataacattgcccgagtaaaagccaagggagcagctgtcaga
gtggacttggaaacaatgtcagcaagagatctgctcaatgcattgaaggaagtcattaac
aatccctcctacaaagagaaggctatgtggttatccaccattcaacacgatcagcctata
aagcccctggaccgagcaatcttctggattgagtttgtcatgcgccacaaaggagccaag
cacctgaggccagccgcccacaacctcacctggttccagtaccactctctggatgtgatt
gggttcctgctggcctgtgtggcaactgttgtatttgtcatcacaaaatgctttctcttt
tgttaccgcaagtttgctaaaacaggaaagaagcaaaagagagagtag

DBGET integrated database retrieval system