KEGG   Capra hircus (goat): 102174580
Entry
102174580         CDS       T02910                                 

Gene name
ADAMTS13
Definition
(RefSeq) ADAM metallopeptidase with thrombospondin type 1 motif 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
chx  Capra hircus (goat)
Brite
KEGG Orthology (KO) [BR:chx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:chx01002]
    102174580 (ADAMTS13)
Enzymes [BR:chx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     102174580 (ADAMTS13)
Peptidases and inhibitors [BR:chx01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   102174580 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin Reprolysin_4 Reprolysin_3 TSP1_CCN TSP1_spondin Reprolysin_5 Peptidase_M10 Reprolysin_2
Other DBs
NCBI-GeneID: 102174580
NCBI-ProteinID: XP_017911638
Position
11
AA seq 1461 aa
MTGSMAPSTVGRCMRGTLTSALFLLSCWALPDPRQQFLQALEPGDVTSYFGPDAAFEGRP
PAPRLRRWSTGHVLHLELLVAVGPDVQRTHGEETERYVLTNLNMGSELLRDPSLGAQFRV
HLVKMVILTQPEDAPKITANITASLLSVCEWSKTVNPEDDTDPGHADLVLYITRFDLELP
DGNRQVRGVTQLGGACSSSWSCLITEDTGFDLGLTIAHEIGHSFGLEHDGMPGSGCGPSG
HVMASDGAAPALALGGPAWSPCSRRQLLSLLSAGRARCVWDPPAPRPGPAGRPPEAQPGL
YYGADEQCRVAFGPTAVACTFRGEHLDMCQALSCHIDPLDPSSCSRLLIPLLDGTECGVE
KWCSRGHCRSLAELAPVGVVHGRWSGWGPASPCSRSCGGGVVTRRRRCDNPRPAFGGRAC
VGSDLQAEMCNTQACETTQLEFMSEQCAQTDGEPLHLSPGGSTSFYRWGTAEQYSKGNAL
CRHVCRAVGESFMVRRGDRFLDGTRCVLGDSQEDGALSLCVSGSCRTFGCDGRMDSGQVR
DVCQVCGGDSSTCRPQNGSFTAGRAREYVTFLTVTPNLTSISVINRRPLFTHLAVRVRGR
YIVAGNGSISASTSYPSLLEDNRVEYRVTLSEDQLPRREEIRIRGPTQDDMEIQVYRRYG
EEYGSPARPDITFTYFQPERRAWAWAPLRGPCSVSCGAGLRQVTYSCWDQSRSEWVEAAR
CAGSRPPEAWSEACTLEPCPPHWAAGDFGPCSASCGGGLREREVRCVEAQGGLLRTAARS
RCRALAPQPAAVDTCNSQPCPQRETDACSSACGADPAVQNTTCMPGADGTGLSATAGPCS
ADEKPPALEPCVEAACPPSWDQLDVRSPGREAASPTGGPRLEVLATHVWTPLAGPCSASC
GQGLAELHFVCMDPALRTPVQEELCDLASKPGSRREACQAAPCPARWETRALAPCPVTCG
GGQVPLAVRCVRMDQGRLVSLPHSKCWPMPRPRPLEDCSPEPCPARWRYKLAACSLSCGG
GVAQRILYCARAHGEDTDEEILPDTQCQGLPRPEQQEACSPEPCPPRWKVTSLGPCSASC
GLGTATRSVACVRLDRGQDTEVDRAACAGLVQPQASIPCIVADCAYRWHVSAWTQCSVSC
GEGIQHRHDACLGPRARVPVPADFCQHLPKPVTVRGCQAGPCTGQGTASPAPHEEATAPG
QTTAATAASPEWPQPHTRLLSPAQGRLPRPQESPVETSVCGRQHLEPTGIIDMRGTTRPD
CAAAIGRPLGEVVTLRVLEGSLNCSAGEMLLLWGRLVWRKMCGKPAGMAFSSQANTLLVR
QRLVRPGGGVLLRYSSQPAPGAFHRGCDTQLFGPRGEILSPSKSPGGRNVGGCRIFIDVA
PRARIAIHALTVDSGTRAEGTDASYILIRDIHSLRTTAFRGQQTLYWESEGSQAEMEFSQ
GFLEAHASLRGQYWTLHTRAR
NT seq 4386 nt   +upstreamnt  +downstreamnt
atgacaggcagcatggctccctccacggtggggaggtgcatgcgggggaccctcacttct
gcgctcttcctcctgagctgctgggcgctccctgatcctcggcagcagtttctgcaggcc
ctggagccaggggacgtgacctcttactttggccctgatgctgcctttgaaggccgcccc
cctgcccctcgcctccggagatggtcgactggacacgtcctgcacctggagctgctggtg
gccgtgggtcccgacgtccagcggacccacggggaggagacagagcgctatgtgctcacc
aacctcaacatggggtcagagctgctgagggacccatccctgggggctcagttccgcgtt
cacctggtgaagatggtcatcctgacccagcctgaggatgctccgaagatcacagccaac
atcaccgcgtcactgctgagcgtctgtgagtggagcaagacagtcaaccccgaggacgac
acggaccctgggcatgccgacctggtcctgtacatcaccaggtttgacctagaattgcct
gatggtaaccggcaggttcggggggtcacccagctggggggcgcctgctcctcctcctgg
agctgccttatcactgaggataccggctttgacctggggctcaccattgcccatgagatt
gggcacagcttcggcctggagcacgacggcatgcctggcagcggctgcgggcccagcggc
cacgtgatggcctcggacggcgcggcgcccgccctcgccctggggggcccggcgtggtcc
ccctgcagccgccggcagctgctgagtctgctcagcgcaggacgggcgcgctgcgtgtgg
gaccctccggcgccgcggcccgggcccgccgggcggcctcccgaggcgcagcccggcctc
tactatggcgcggacgagcagtgccgcgtcgccttcggccccacggcggtcgcctgcacc
ttccgcggggagcacctggacatgtgccaggctctgtcctgccacatagaccccctggac
ccaagcagctgtagccgcctgcttattcctctcctggacgggacagagtgtggcgtggag
aagtggtgctccaggggtcactgccgctcgctggcggagctggcccccgtgggggtggtg
cacgggcgctggtctggctgggggcccgccagtccttgctcccgctcctgtggaggcggt
gtggtcaccaggaggcggcggtgtgacaaccccagacctgcgtttggggggcgtgcgtgc
gtaggttctgacctccaggccgagatgtgcaacacccaggcctgtgagacgacccagctg
gagttcatgtccgagcagtgtgcgcagacagatggcgagcccctgcacctctccccgggg
ggcagcacctccttctaccgctggggaaccgcggagcagtacagcaaagggaacgccctg
tgcagacacgtgtgccgggctgtcggcgagagcttcatggtgcggcgtggggaccgtttc
ctggacggcacgcgctgtgtgctgggcgactctcaggaggatggggccctgagcctatgc
gtgtcaggcagctgcaggacgttcggctgtgatggcaggatggactccgggcaggtgcgg
gacgtatgccaggtgtgcggcggggacagcagcacgtgccggccgcagaatggctccttc
acggccggaagggccagagagtacgtcacattcctgaccgtcacccccaacctcaccagc
atctccgtcatcaaccgcaggcctctcttcacacacctggcagtgagggtgcgtggccgc
tacatcgtggccggaaacgggagcatttctgccagcaccagctacccctccctcctggag
gacaaccgcgtggagtacagggtgaccctgagtgaggatcagctgccccgccgggaggag
atccgcatccggggccccacccaggacgacatggagatccaggtttacaggcgctacggc
gaggagtacggcagccccgcccgccccgacatcaccttcacctacttccagcccgagcgg
cgggcctgggcgtgggccccattgcgggggccgtgctctgtgagctgcggggcagggctg
cgccaggtgacctacagctgttgggaccagtccaggagcgagtgggtggaggctgcccgc
tgtgcggggagccggcccccagaggcgtggtcagaggcctgcaccctcgagccctgtccc
cctcactgggcggctggagacttcggcccctgcagcgcctcgtgtgggggtggcctgcgg
gagcgggaggtgcgctgcgtggaggctcagggcggcctgctgaggaccgctgcccgctcc
cggtgccgagcgctggccccgcagccagcggccgtggatacctgcaattcccagccctgc
ccccagagggagacagacgcgtgctcgtcggcctgtggagcagacccggccgtgcagaac
acgacctgtatgccgggggcagatggcacggggctgtcggcaactgctgggccctgctct
gcagacgagaagccacctgccctggagccctgtgtcgaggcggcctgtcctcccagctgg
gaccagctggacgtccggtccccggggcgggaggctgcgtccccaacgggcggccccagg
ctggaggtgctcgccacgcacgtgtggacacccctggcggggccgtgctctgcctcctgc
ggtcaaggcctggcggagctgcatttcgtgtgcatggaccctgccctcaggacacccgtc
caggaagagctgtgtgacctggcaagcaagcccgggagccggcgggaggcctgccaggct
gccccatgcccggccaggtgggagacccgagccttggcaccgtgcccagtgacctgtgga
ggcgggcaggtgccactggctgttcgctgtgtgaggatggaccaaggccgcctcgtctcc
ctgcctcactccaagtgctggcccatgccccggcctaggcccctcgaggactgcagcccg
gagccctgccctgccaggtggcggtacaagctggcggcctgcagcctgagctgtggggga
ggggtggcgcagaggatcctgtactgtgcccgggcccacggggaggacacggacgaggag
atcctgccggacacccagtgccaggggctgccccgcccagagcagcaggaggcctgcagc
ccggagccctgcccgcccaggtggaaagtcacgtctctcggcccgtgctcggccagctgt
gggctcggcacggccactcgctcggtggcctgtgtgcggctggaccgcggccaggacacg
gaggtggacagggcagcctgcgcgggcctcgtgcagccacaggccagcatcccttgcatc
gtcgccgactgcgcctaccggtggcatgtcagcgcctggacacagtgctccgtctcctgt
ggggagggcatccagcatcggcatgatgcctgcctagggccccgggcccgggtgcctgtg
cccgccgacttctgccagcaccttcccaagccggtgaccgtgcggggctgccaggccggg
ccctgcacggggcaggggacggccagcccggcgccccacgaggaagccactgctccaggc
cagaccacagctgccacagctgcgtccccggagtggccccagccccacacccgcctcctc
tccccagctcaaggacgcctgcccaggccccaggaaagcccagtggagaccagtgtctgt
ggccggcagcacctcgagccaacgggaatcatcgacatgcgaggcacgacgcggccggac
tgtgcggcggccatcgggcggcccctgggtgaagtggtgaccctccgggtcctggagggt
tctctcaactgcagtgctggggagatgctgctgctttggggcaggctcgtgtggaggaag
atgtgcgggaagccggccggcatggctttcagctcccaagccaacacgctgctggtgagg
cagcgtcttgtgcggcccggaggcggagtgctgctgcggtactcaagccagcctgccccg
ggagccttccaccgaggatgtgacacgcagctcttcggaccccggggtgaaatcttgagc
ccatcgaagagtccgggtgggaggaacgtggggggctgtcgcatcttcatcgacgtggcc
ccgcgggccaggatcgccatccatgccctgaccgtggacagcggcaccagagctgaggga
actgatgccagttacatcttgatccgggacatccacagcctgaggacaacggcatttcgt
gggcaacagacgctctactgggagtcagagggcagccaggcagagatggagtttagccag
ggcttcctggaagcacacgccagccttcggggccagtactggaccctccacacgagagct
cgttag

DBGET integrated database retrieval system