KEGG   Capra hircus (goat): 102174910Help
Entry
102174910         CDS       T02910                                 

Gene name
MARS
Definition
(RefSeq) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
chx  Capra hircus (goat)
Pathway
chx00450  Selenocompound metabolism
chx00970  Aminoacyl-tRNA biosynthesis
chx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    102174910 (MARS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    102174910 (MARS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:chx01007]
    102174910 (MARS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:chx03016]
    102174910 (MARS)
Enzymes [BR:chx01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     102174910 (MARS)
Amino acid related enzymes [BR:chx01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   102174910 (MARS)
Transfer RNA biogenesis [BR:chx03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    102174910 (MARS)
 Prokaryotic type
   Other AARSs
    102174910 (MARS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g GST_N_5 WHEP-TRS tRNA-synt_1 GST_C GST_C_2 Anticodon_1 GST_N_2 GST_N DUF16
Motif
Other DBs
NCBI-GeneID: 102174910
NCBI-ProteinID: XP_005680339
Position
5
AA seq 901 aa AA seqDB search
MRLFVSEGAPGSLPVLAAAGRAQGRAELLISTVGPEECVVPFLTRPKVPVLQLDSGNYLF
STSAICRYFFLLSGWEQDDLTNQWLEWEATELQPALSAALYYLVVQGKKGEDVLGPVRRA
LMHIDHSLSRRSCPFLAGETESLADIVLWGALYPLLQDPSYLPEELGALHSWFQTLSSQE
PCQRAAETVLKQQGVLALRPYLQKQPQPGSLEGRLISNEPEEEELATLSEEEIAVAVAAW
EKGLESLPPLRPQQNPVLPVAGERNVLITSALPYVNNVPHLGNIIGCVLSADVFARYSRL
RQWNTLYLCGTDEYGTATETKAMEEGLTPQEICDKYHVIHADIYRWFNISFDFFGRTTTP
KQTKITQDIFQRLLARGFVLQDTVEQLRCEHCARFLADRFVEGVCPFCGYEEARGDQCDK
CGKLINAIELKKPQCKVCRSCPVVKSSQHLFLDLPKLGARVEEWLEKTLPGSDWTPNARF
IIRSWLRDGLKPRCITRDLKWGTPVPLEGFEDKVFYVWFDATIGYLSITANYTDQWEKWW
KNPEQVNLYQFMAKDNVPFHGIVFPSSALGAEDNYTLVSHLIATEYLNYEDGKFSKSRGV
GVFGDMAQDTGIPADIWRFYLLYIRPEGQDSAFSWTDMLFKNNSELLNNLGNFINRAGMF
VSKFFGGFVPEMVLTSDDQRLLTHVTLELQHYHQLLEKVRIRDALRSILTISRHGNQYIQ
VNEPWKRIKGGEADRQRAGTVTGLAVNIAALLSVMLQPYMPTVSATIQAQLQLPPPACSI
LPTNFLCTLPAGHQIGMVSPLFQKLENDQIESLKQRFSGGQLEESLALKAKASPKTAAGP
QQIQALTEEVTKQGNIVRELKAQKADKNQIAAEVAKLLDLKKQLAQAEGKPLETPKGKKK
K
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
atgaggttgttcgtgagtgagggcgctccggggagtctgcctgtgctggccgcggctggg
agggcccagggcagagcggagctgctcatcagcactgtaggcccagaagagtgtgtggtc
ccattcctgacccggcctaaggtccctgtcttgcagctggatagtggcaactacctcttc
tccaccagtgcaatctgtcgatacttctttcttttatctggctgggagcaagatgatctc
accaaccagtggctggaatgggaagcaacagagctgcagccagctttgtccgctgccctg
tactatttagtggtccaagggaagaagggagaagatgttcttggcccagttcggagagcc
ctgatgcatattgaccacagcttgagtcgtcggagctgtccattcctggctggggagaca
gaatctctagctgatattgttttgtggggagcgctctacccgttactccaagacccatcc
tatctccctgaggaactgggtgccctgcacagctggttccagacactgagttcccaggag
ccatgtcagcgagctgcagagactgtgctgaagcagcagggtgtcctggccctccggccc
tacctccagaagcagccccagcccggctcccttgagggcaggcttatcagcaatgagcct
gaggaggaggaactggctactctgtctgaggaggagattgccgtggctgtagctgcttgg
gagaagggcctggaaagcttgccccctcttcggccgcagcagaatccagtgttgcccgtg
gctggggagagaaatgtgctcatcaccagcgccctcccttacgtcaacaatgttccccac
cttggaaacatcatcggctgtgtgctcagtgccgacgtctttgcaaggtactcccggctc
cgtcagtggaacaccctctacctgtgtgggacagatgagtatggtacagcgacagagacc
aaggctatggaggagggactaaccccacaggagatctgtgacaagtaccacgttatccac
gctgacatctaccgctggtttaacatttcgtttgacttttttggtcggactaccactccg
aagcagaccaaaattacccaggacatcttccagcggctgctggcccgaggttttgtgctg
caagatactgtggagcaactgcggtgtgagcactgtgcccgcttcctggctgaccgcttt
gtggagggtgtgtgtcccttctgtggctacgaggaggcccggggtgaccagtgtgacaag
tgtggcaagctcatcaatgccattgagctcaagaagcctcagtgtaaagtctgccggtcg
tgccctgtggtaaaatcctctcagcacctgtttctggacctacctaagctgggagcacgg
gtggaggagtggttggagaaaacgttgcctggcagtgactggacacccaacgcccggttc
atcatccgttcttggcttcgagatggcctcaagccccgctgcataacccgagacctcaag
tggggaacccctgtgcccttagaaggttttgaggacaaggtgttctatgtctggtttgat
gccaccattggctacctgtccatcacagccaactacacagaccaatgggagaagtggtgg
aagaacccagaacaagtgaacctgtatcagttcatggccaaggacaatgttcccttccat
ggcatagtctttccttcttcagccctaggagctgaggacaactacaccttggtcagccac
ctcattgctacagaatatctgaattacgaggatgggaaattctctaagagccggggtgtg
ggagtgtttggggacatggcccaggacacagggatccctgctgacatctggcgcttctat
ctgctgtacattcggcctgaggggcaggacagtgccttctcctggacagacatgttgttc
aagaataattccgagctgcttaacaacctgggcaacttcatcaacagagctgggatgttt
gtgtccaagttttttgggggttttgtgcctgagatggtgctcacctctgatgatcagcgc
ctgctgacccatgtcaccctggagctccagcactaccaccagctgctagagaaggttcgg
atccgggatgccttacgtagcatcctcaccatctctcgccatggcaaccagtacattcag
gtgaatgagccctggaagcggattaaaggcggcgaagctgacaggcagcgggcagggaca
gtgacaggcttggctgtgaatatagctgccttgctctccgtcatgctccagccttacatg
cctacagttagtgccaccatccaagcccagctgcagctcccacctccagcctgcagtatc
ctgcccacgaactttctatgcaccttaccagcaggacaccagattggcatggtcagtccc
ttgttccaaaaattggaaaatgaccagattgaaagtctgaagcagcgcttcagtgggggc
cagctagaagagtccttggctttaaaggcaaaagcatcccccaagacagcagctggaccg
cagcagatccaagcactgacagaggaagtgaccaagcagggcaacattgtccgagaattg
aaggcacagaaggcagacaagaaccagattgctgcagaggtggctaaactcttggatctg
aagaaacaattggctcaagctgaggggaaacccctggaaacccctaaaggcaagaagaaa
aagtaa

DBGET integrated database retrieval system