KEGG   Capra hircus (goat): 102175015
Entry
102175015         CDS       T02910                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
chx  Capra hircus (goat)
Pathway
chx00230  Purine metabolism
chx00240  Pyrimidine metabolism
chx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102175015 (DCK)
   00240 Pyrimidine metabolism
    102175015 (DCK)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     102175015 (DCK)
SSDB
Motif
Pfam: dNK Thymidylate_kin AAA_18 AAA_28 AAA_33 CoaE DUF932
Other DBs
NCBI-GeneID: 102175015
NCBI-ProteinID: XP_005681795
UniProt: A0A452G244
Position
6
AA seq 260 aa
MATPPKRSCPSPAASSEGTRIKKISIEGNIAAGKSTFVNILKQVCEDWEVVPEPVARWCN
VQSTQNEFEELTTSQKSGGNVLQMMYEKPERWSFTFQSYACLSRIRAQLAALNGKLKDAE
KPVLFFERSVYSDRYIFASNLYESDCMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLRA
TPEKCLNRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNE
DFKDKHDSLIEKVKDFLSTL
NT seq 783 nt   +upstreamnt  +downstreamnt
atggccaccccacccaagagaagctgcccgtctcccgcagccagctctgaggggacccgc
atcaagaaaatttccatcgaagggaacatcgctgctggaaagtcaacgtttgtgaatatc
ctgaaacaagtctgtgaggactgggaagtggtgcctgaacctgttgccaggtggtgcaat
gttcagagtactcagaatgaatttgaggaactgacaacatctcagaaaagtggcgggaat
gttcttcagatgatgtatgagaaacctgaacgatggtcttttaccttccagtcatatgcc
tgcctcagtcgaatacgagctcagcttgctgctctcaatggaaaactcaaagatgcagag
aaaccagtattattttttgaacgatctgtgtatagtgacaggtatatttttgcatctaat
ttgtatgaatctgactgcatgaatgaaacagagtggaccatttatcaagactggcatgac
tggatgaataaccagtttggccaaagccttgaactagatggaatcatttatcttagagcc
actcctgagaaatgcttgaatagaatatatttacggggaagaaacgaagaacaaggcatt
cctcttgaatacttggagaaacttcactataagcatgaaagctggctcctgcatagaaca
ctaaaaaccaactttgattatctacaagaagtgcctatcttaacactggatgttaatgaa
gactttaaagacaaacatgacagtctaattgaaaaggtaaaagactttttgagcactttg
tga

DBGET integrated database retrieval system