KEGG   Capra hircus (goat): 102175138Help
Entry
102175138         CDS       T02910                                 

Gene name
PIGT
Definition
(RefSeq) phosphatidylinositol glycan anchor biosynthesis class T
  KO
K05292  GPI-anchor transamidase subunit T
Organism
chx  Capra hircus (goat)
Pathway
chx00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
chx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    102175138 (PIGT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 102175138
NCBI-ProteinID: XP_005688650
UniProt: A0A452FI42
Position
13
AA seq 578 aa AA seqDB search
MAAAVRIFLLLLLLLGPGGWGQAEPPRDSLREELVITPLPSGDVAATFQFRTRWDSELQR
EGVSHYRLFPKALGQLISKYSLRELHLSLTQGFWRTRYWGTPFLQAPSGAELWAWFQETV
TDVDESWKELSNVLSGIFCASLNFIDSTNTVTPTASFKPLGLANGTDHSFLRYAVLPREV
VCTENLTPWKKLLPCSSKAGLSVLLKADRLFHTSYHSQAVHIRPVCRNARCTSVSWELRQ
TLSVVFDAFVTGQGKKDWSLFRMFSRTLTEPCPLASESRVYVDITSYGQDNETLEVYPPP
LTTYQDVILGTRKTYAVYDLLDAAVVSNSRSLNIQLKWKRPPENEAPPVPFLYAQRYVSG
YGLQSGELSTLLYNTHPYRAFPVLLLDSVPWYLRLYVHTLTITSKGKENKPSYIHYQPAQ
DRMQPHLLEMLIQLPANSITKVSIQFERALLKWTEYTPDPNHGFYVSPSVLSALVPSVVA
AKPGDWEESPLFNSLFPVSDSSSYFVRLYTEPLLVSLPTPDFSMPYNVVCLTCTVVAVCY
GSFYNLLTRTFQIEEPRKGGLVKRLANLIRRARGVPPL
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccgtaaggattttcctgctgttgctgctgcttctgggaccgggcggctgg
ggccaggcggagcccccacgcgacagcttgagggaggagctagtcatcaccccgctgcct
tcaggggacgtagccgccacattccagttccgcacgcgctgggattcggagctgcagcgg
gaaggagtgtctcactataggctcttccccaaagccttggggcagttgatctccaagtat
tctctccgggaactgcacctgtccttaacccaaggcttctggaggactcgatactggggg
acgcccttcttgcaggccccatcgggggcagagctgtgggcttggttccaagagaccgtc
accgacgtggatgagtcctggaaggagctcagtaacgtcctctccgggatcttctgcgcc
tctctcaacttcatcgactctaccaacacagtcacgcccactgcctccttcaaacccctg
gggctggccaatggcacggaccactccttcctgcgctatgcggtgctgccgcgagaggtc
gtctgcaccgagaacctcaccccatggaagaagctcttgccctgcagctccaaggcaggc
ctctcggtgctgctgaaggctgaccgcctgttccacacgagctaccactcccaggcagtg
catatccgccctgtttgcagaaatgcacgctgtaccagcgtctcctgggagctgaggcag
accctttctgttgtatttgatgccttcgtcactggacaggggaagaaggactggtccctc
ttccggatgttctcccgaactctcactgagccctgccccttggcttcggagagccgagtc
tatgtggacatcaccagctatggccaggacaacgagacattggaggtgtacccgcccccc
cttaccacataccaagacgtcatcctgggcacccggaagacctatgccgtctatgacctc
ctggatgcagctgtggtcagcaactcgcgcagcctcaacatccagctgaagtggaagagg
cccccagagaatgaggcccccccggtgcccttcctgtacgcccagcggtatgtgagcggc
tacgggctgcagagcggggagctgagcacgctgctgtacaacacccacccgtaccgggcc
ttccctgtgctgctgctggacagcgtgccctggtacctgcggctgtatgtgcacacgctc
accatcacgtccaagggcaaggagaacaaaccaagttacatccactaccagcctgcccag
gaccggatgcagccccacctcctggagatgctgattcagctgccggccaactccatcacc
aaggtctccatccagtttgagcgggcactgcttaagtggactgagtacaccccggacccc
aaccatggcttctatgtcagcccgtctgtcctcagcgccctcgtgcccagtgtggtggca
gccaaacccggggattgggaagagagccccctcttcaacagcctcttcccagtctctgac
agctccagctactttgtgcggctctacacggagccgctgctggtgagcctgcccacgccg
gacttcagtatgccctacaacgtcgtctgcctcacgtgcaccgtggtggccgtgtgctac
ggctccttctacaacctcctcacccgcaccttccagatcgaggagcccaggaagggcggc
ctggtcaagcggctcgccaacctcatccggcgtgcccgaggtgtccccccgctctga

DBGET integrated database retrieval system