KEGG   Capra hircus (goat): 102175162Help
Entry
102175162         CDS       T02910                                 

Gene name
ST3GAL6
Definition
(RefSeq) ST3 beta-galactoside alpha-2,3-sialyltransferase 6
  KO
K03792  neolactotetraosylceramide alpha-2,3-sialyltransferase (sialyltransferase 10) [EC:2.4.99.6]
Organism
chx  Capra hircus (goat)
Pathway
chx00601  Glycosphingolipid biosynthesis - lacto and neolacto series
chx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    102175162 (ST3GAL6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:chx01003]
    102175162 (ST3GAL6)
Enzymes [BR:chx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.6  N-acetyllactosaminide alpha-2,3-sialyltransferase
     102175162 (ST3GAL6)
Glycosyltransferases [BR:chx01003]
 Terminal extension
  Sialyltransferase
   102175162 (ST3GAL6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 102175162
NCBI-ProteinID: XP_017913309
UniProt: A0A452EGP8
Position
1
AA seq 331 aa AA seqDB search
MRGCLLAIFLSALFLYYVLHCILWRTNDYGVTPMEMKPRNKIQPCLSKPAFASLLRYHQF
HPFLCAANFKNTASFYGSDKFDLPYGIRASATHFRLALWKLPNCDLFDEFDNVPCKKCVV
VGNGGILKNKTLGEKIDSYDVIIRMNNGPVLGHEEEVGRRTTFRLFYPESVFSDPNHSDP
NTTVILTAFKPLDLKWLLELLTGGKINPNGFWKEPALNLIYKPYQIRILDPYITRMAAYE
LLHFPKAFPKNEKPKHPTTGIIAITLAFHICHEVHLAGFKYNFSDLKSPLHYYGNATMSL
MSENEYHNVTAEQLFLKDIIEKNFVTDLTQE
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgagagggtgcctcctggccatcttcctgagtgctctcttcctctattatgtgctgcat
tgtatattgtggcgaacaaatgactatggggtgacacctatggaaatgaagccgagaaat
aagatccagccttgtttatcaaagccagcttttgcctctctcctgaggtatcatcagttt
cacccttttctgtgtgcagcgaatttcaaaaatactgcttccttctacggtagcgataag
tttgatttgccctatgggataagagcatcagccacacactttcgacttgctctttggaaa
ctgccaaattgtgatctctttgatgagtttgacaatgtgccgtgtaagaagtgtgtggtg
gttggtaatggaggaattttgaagaataagacattaggagaaaaaattgactcctatgat
gtaataataagaatgaataacggtcctgttttaggacatgaagaggaagttgggagaagg
actaccttccgacttttttatccagaatctgttttttcagatcctaatcacagtgaccct
aatactacggtgattctcactgcttttaagccacttgatttaaagtggctgttggaattg
ttgacaggtggcaaaataaatcctaatggtttttggaaggaaccagccttaaatctgatc
tataaaccttatcaaatcagaatattagatccttacatcaccagaatggcagcatacgaa
ctgcttcatttcccgaaagcgtttcccaaaaatgagaaacccaaacacccaaccacaggc
attattgccattacattggcatttcacatatgtcatgaagttcaccttgctggctttaag
tacaacttttctgacctcaagagccctttgcactactatgggaatgccaccatgtctttg
atgagtgagaatgaatatcacaatgtgactgcggagcagctctttctgaaggacattata
gaaaaaaactttgtaaccgacttgacccaagagtaa

DBGET integrated database retrieval system