KEGG   Capra hircus (goat): 102175514Help
Entry
102175514         CDS       T02910                                 

Gene name
UTP18
Definition
(RefSeq) UTP18, small subunit processome component
  KO
K14553  U3 small nucleolar RNA-associated protein 18
Organism
chx  Capra hircus (goat)
Pathway
chx03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:chx00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    102175514 (UTP18)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:chx03009]
    102175514 (UTP18)
Ribosome biogenesis [BR:chx03009]
 Eukaryotic type
  90S particles
   U3 small nucleolar RNA-associated proteins
    102175514 (UTP18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANAPC4_WD40 WD40 Cytochrom_D1 RskA Hira ARD
Motif
Other DBs
NCBI-GeneID: 102175514
NCBI-ProteinID: XP_005693695
UniProt: A0A452E9K0
Position
19
AA seq 547 aa AA seqDB search
MPPERRRRVRPDRKTQVRPDRRAGARWGGPPRKAAPSCQRKSLAWPRAAAAAVSVAAAEE
ERLRLRNRLTLEADKPAVERRLEELVFGDLEDDEDALLRRLRVPRVQVQEDSDDSEVEKE
AKDNFLPQKKPVWLDEEDEDEEMVDMMNNRFRKDMMKNASENQLSKDELQKRLKEEFQHA
MGGVPAWAEANKWKTPSDDESEEDEDDLLQRTGNFISTSTSLPKGILKMKNCQHANAERP
TTARISSVQFHPGAQVVMVAGLDNAVSLFQVDGKTNPKIQSIYLEKFPIFKACFSANGEE
VLATSTHSKILYVYDMLAGKLIPVHQVRGLKEKIVRSFEVAPDGSFLLINGVAGYLHLLS
MKTKELIGSMKINGRIAASTFSSDSKKVYASSGDGDVYVWDVNSRKCLNRFVDEGSLYGL
SIATSRNGQYVACGSNCGVVNIYNQDSCLQETNPKPIKAVMNLVTGVTSLTFNPTTEILA
IASANMKEAVRLVHLPSFTVFSNFPVVKKKNISLIHTMDFSPRSGYFALGNEKGKALMYR
LHHYPDF
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgccgccggaaagaaggcgccgagtgaggccggaccgcaagacccaagtgaggccggac
cggagagccggagcgcggtggggcgggccgccccgaaaggctgccccctcatgccagcgg
aagtcgctggcctggccgcgcgcggcggccgctgcagtctcagttgcggcggcggaggag
gaacggctccgactgaggaaccgtctgacgctagaggcggacaagccggcagtagagcgg
cgcctggaggagctggtcttcggcgacttggaggacgacgaggatgcgctgctgcggcgt
ctacgggtcccgcgggttcaagtacaggaagactcagatgactcagaagtggagaaggaa
gcaaaagataattttctacctcaaaagaagccagtttggctggatgaagaagatgaagat
gaggagatggttgacatgatgaacaatcgttttcggaaagatatgatgaaaaatgccagt
gaaaatcaactttcaaaagatgagcttcaaaagagacttaaagaagaatttcagcatgct
atggggggagtacctgcctgggcagaggccaataaatggaaaacaccttcagatgatgaa
agtgaagaggatgaagatgatttgttgcaaaggactgggaatttcatatccacatctaca
tctcttcctaaaggaatcttaaagatgaagaactgccagcatgctaatgctgaacgtcct
actactgctcggatctcatctgtgcagttccatcctggggcacaggttgtgatggtcgct
ggactagataatgccgtatccctatttcaggttgatggaaaaacaaatcctaaaattcag
agcatctatttggaaaagtttccgatctttaaggcttgttttagtgctaatggagaagag
gttttagccacgagcactcacagcaagattctttatgtctatgatatgctggctggaaag
ctaattcctgtgcatcaagtaagaggtttgaaagagaagatagtgaggagctttgaagtt
gccccagatgggtccttcctgcttataaatggtgttgctggatatcttcatttgctgtct
atgaagacaaaagagctaattggtagtatgaaaattaatgggaggattgcagcatccaca
ttctcttcagatagtaagaaagtatatgcatcttcaggggacggggatgtttatgtttgg
gatgtgaactctagaaagtgccttaacagatttgttgatgaaggcagcttatatggatta
agcattgccacatctaggaatggacagtatgtggcttgtggttctaattgtggagtggta
aacatatacaatcaagattcttgtctccaggaaacgaacccaaagccaataaaagcggtg
atgaacttggttacaggtgttacttctctgaccttcaatcctactacagaaatcttggca
attgcttcagcaaacatgaaagaagcagtcagactggtccaccttccttcctttacagta
ttttcaaacttcccagttgttaagaagaagaatatttctcttattcataccatggatttt
tctcccagaagtgggtattttgccttggggaatgaaaaagggaaggccctgatgtatagg
ttgcatcattacccagacttttaa

DBGET integrated database retrieval system