KEGG   Capra hircus (goat): 102176082Help
Entry
102176082         CDS       T02910                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
chx  Capra hircus (goat)
Pathway
chx00561  Glycerolipid metabolism
chx01100  Metabolic pathways
chx04714  Thermogenesis
chx04723  Retrograde endocannabinoid signaling
chx04923  Regulation of lipolysis in adipocytes
Module
chx_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    102176082 (MGLL)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    102176082 (MGLL)
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    102176082 (MGLL)
  09159 Environmental adaptation
   04714 Thermogenesis
    102176082 (MGLL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:chx01002]
    102176082 (MGLL)
Enzymes [BR:chx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102176082 (MGLL)
Peptidases [BR:chx01002]
 Serine Peptidases
  Family S33
   102176082 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Esterase Lipase_3 LIDHydrolase Abhydrolase_5 Thioesterase PGAP1 PAF-AH_p_II DUF1350
Motif
Other DBs
NCBI-GeneID: 102176082
NCBI-ProteinID: XP_017922541
Position
22
AA seq 376 aa AA seqDB search
MQTAPEDPFRMPEERSPRLTPQNVPYQDLPHLVNADGQHLFCRYWKPSGAPRALVFVSHG
AGEHCGRYEELAQMLVGLGLLVFAHDHASGSLPRSQPFVSTGQSTGASASAPTEQDVARP
LAREVGHGQSEGERMVVSDFHVFIRDVLQHVDAVQKEHPGLPVFLLGHSMGGAICILTAA
ERPGHFSGMVLISPLVVASPDSATLFKDPQISFEEVCQLTIRTVVSWMPASLWVFAAKVL
NLVLPNMSLGRIDSSVLSRNKTEVDIYNSDPLVCRAGLKVCFGIQLLNAVSRVERALPKL
TLPFLLLQGSADRLCDSRGAYLLMESAKSQDKTLKIYEGAYHILHKELPEVTSSVFREIN
TWVSQRTAVAGAGCPP
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgcagacagcacctgaagatcctttcagaatgccagaggaacgttcccccaggctgacc
ccacagaacgtcccctaccaggacctccctcacctggtcaacgcggacggacagcacctc
ttctgccggtactggaaaccctcaggcgcgcccagggcgctggtgttcgtgtcccacggg
gccggcgagcactgcggccgctacgaggagctggcgcagatgctggtggggctgggcctg
ctggtcttcgcccacgatcacgcatcagggtctcttccaaggagtcagcccttcgtatca
actggccaaagtactggagcttcagcatcagcaccgacggagcaggacgtggctagacca
ctggcgagagaggttggccatgggcagagcgaaggcgagaggatggtggtgtccgacttc
cacgtcttcatccgggacgtgctgcagcatgtggacgccgtgcagaaggaacacccgggg
ctgcccgtcttccttctgggccactccatgggcggagcgatctgcatcctcacagccgcg
gagcggccgggccacttctcgggtatggtcctcatctccccgctggtcgtcgccagccca
gactcggcgacacttttcaaggatcctcaaataagtttcgaagaagtgtgccagttgaca
ataagaaccgttgtatcgtggatgccagcttctctgtgggtcttcgctgcgaaagttctg
aacctcgtcctgccgaacatgtccctgggccggatcgactccagcgtgctctcgagaaat
aagacagaggtggacatctacaactcggaccccctggtctgccgggcggggctcaaagtc
tgcttcggcatccagctgctcaacgcggtgtcgcgggtggagcgggcgctgcccaagctg
acgctgcctttcctgctgctgcagggctccgccgaccgcctctgcgacagcagaggtgcc
tacctgctcatggagtcggccaagagccaggacaagacactcaagatttatgaaggtgcc
taccacatcctccacaaagagcttcccgaggtgaccagctccgtcttccgggagataaac
acgtgggtctcgcaaaggacagcggtggcgggagcagggtgcccaccctga

DBGET integrated database retrieval system