KEGG   Capra hircus (goat): 102178510Help
Entry
102178510         CDS       T02910                                 

Gene name
PARP12
Definition
(RefSeq) poly(ADP-ribose) polymerase family member 12
  KO
K15259  poly [ADP-ribose] polymerase 7/11/12/13 [EC:2.4.2.30]
Organism
chx  Capra hircus (goat)
Brite
KEGG Orthology (KO) [BR:chx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    102178510 (PARP12)
Enzymes [BR:chx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     102178510 (PARP12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP WWE HTH_53 zf-CCCH zf-CCCH_8
Motif
Other DBs
NCBI-GeneID: 102178510
NCBI-ProteinID: XP_013818987
Position
4
AA seq 702 aa AA seqDB search
MAPAALLREVTQVLCAAGGSLELEELRRRVRPSVVGEVLDRLLRERGRFVVAQRAAGAGA
AAVERVVLAVSPLRLCGAHLGPKPGCAGLCAQLHLCKFLFYGKCKFLRDGKDCRNGHNLM
SNHNISVLKTHGLDHLNFGELCMLLFQNDPLLLPEICLHYNKGDGPYGSCSFKKHCIKLH
VCQYFSQGECKFGTGCKRSHDFSNSENLEKLEKLGMRPELVSKLPSIYRNAHDIKSKSSA
SIRVPPLPSQSQGTSERRDTGSVSLNTATQEESDQICLFHIWKSCSFQDKCSKVHFHLPY
RWQVLDGGKWKDLHKMELIEEAYSNPARDGVTCTETSSSFLIGFLNFDTMKFGATQARRL
STASSVTKPPHFILTTNWVWYWTDEFGSWQEYGRQGMDHPVTSVTSSDLEKAYLAYCAPG
SNPQAATLRFQAGKHTYELDFKAFIQKNVIYGTVRKVCRRPKYVSPQDVKMKQTCSINSQ
GLKNIPDHWDRSALPDTGFKRITVPSSSEEFQKVWNLFTCTMPLYSIQKIERVQNPALWE
VYQWQKEQMQKRNGGKMVDERQLFHGTSTGFVDAICQQNFDWRVSGLHGTSYGKGSYFAR
DAAYSHHYSKTDSNTHTMFLARVLVGEFVRGSTAYVRPPIKEAQGNILYDSCVNSMSEPS
IFVIFEKHQAYPEYIIQYTASTKPPAAAPALFSLASFFSGRQ
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atggcgccggccgccctcctccgtgaggtgacccaggtgctgtgcgcggccgggggctcc
ttggagctggaggagctacggcgccgcgtgcggccgagcgtcgtcggcgaagtgctggac
cggctgctgcgggagcgcgggcgcttcgtggtggcgcagcgggcggccggggcgggcgcg
gcggccgtcgagcgcgtggtgctggccgtgtcgccgctgcggctctgcggcgcccatctg
ggcccgaagccgggctgcgcggggctgtgcgcgcagctgcacctctgcaagtttttgttc
tacggcaagtgcaagttcctcagggacgggaaggactgtaggaacggccacaacttgatg
tccaatcacaacataagcgtgctgaaaacacatggcttggaccacctcaacttcggtgag
ctctgcatgctcctgtttcagaacgaccccttgctcttgccagagatctgccttcattac
aacaaaggagatggaccgtatggctcttgttcctttaaaaagcactgtatcaagctccat
gtctgccagtatttttcacagggtgaatgcaagtttggcactggctgtaagagatcccat
gatttctctaattctgagaacctggaaaaactggagaagttgggtatgaggccggagctg
gtgagcaagctgccttccatttacagaaatgctcatgacatcaagagtaaaagctctgcc
tccatccgggtgccacctctaccctcgcagtcacaggggacttccgaaagaagagacaca
ggttctgtgtccctaaacactgccacccaagaggagagtgatcagatctgcttgttccat
atctggaagagctgtagctttcaagataagtgcagtaaagttcatttccacttgccatat
cgatggcaagtcttagatggaggcaagtggaaggatttgcacaaaatggagcttattgaa
gaggcatatagcaatcctgcaagagacggggtcacgtgcactgagacatccagtagcttt
ctcattggttttctgaactttgacaccatgaagtttggtgccacccaggctcgccgtctc
tccacagcctcctcggtcaccaaacctccacacttcatcctcaccaccaactgggtttgg
tactggactgatgagtttggctcttggcaggaatatggacgacaaggcatggatcaccct
gtgaccagcgtcaccagcagtgatttggagaaggcctacctggcgtactgtgccccgggg
tctaacccccaagcagccaccctgaggttccaggcaggaaagcacacatatgagttagac
ttcaaagccttcattcagaaaaacgtgatctatggcacagttagaaaggtttgccgaaga
cccaaatatgtgtctccccaagatgtgaagatgaagcaaacctgcagcatcaattctcaa
ggcctaaagaacattcctgaccattgggatcgctcggccctgccggacactggctttaag
aggatcaccgtcccttcttcctcagaagagtttcagaaggtctggaacctcttcacctgt
acgatgcctctctactccattcagaagattgaacgggtccagaaccccgccctctgggaa
gtctatcagtggcaaaaagagcagatgcagaagaggaacggtggcaagatggtggacgaa
aggcagctgttccacggcaccagcactggttttgttgatgccatctgccagcagaacttt
gactggcgggtcagtggtctccatggtacttcctacggcaaagggagctactttgcccgg
gatgctgcatactcccaccactacagcaaaaccgacagcaacacccacaccatgttcttg
gctcgggtgctggtgggcgagttcgtccggggcagcaccgcctacgtccgccccccaatc
aaggaggcccaaggcaacatcctgtacgacagctgcgtgaacagcatgtccgaaccctcc
atctttgtgatcttcgagaagcaccaggcctatccggagtacatcatccagtacaccgcc
tccaccaagcccccggccgccgcccccgccctcttctccttggcttctttcttcagcggc
cggcagtga

DBGET integrated database retrieval system