KEGG   Capra hircus (goat): 102179453
Entry
102179453         CDS       T02910                                 

Gene name
RDH5
Definition
(RefSeq) retinol dehydrogenase 5
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
chx  Capra hircus (goat)
Pathway
chx00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102179453 (RDH5)
Enzymes [BR:chx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     102179453 (RDH5)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR
Other DBs
NCBI-GeneID: 102179453
NCBI-ProteinID: XP_005680455
UniProt: A0A452EKV5
Position
5
AA seq 318 aa
MWLPLLLGVLLWAALWLLRDRQCLPASDAFIFITGCDSGFGRLLALRLDQRGFRVLASCL
TPSGAEDLQRVASSRLHTTLLDVTDPQSVRQAAKWVETHVGKTGLFGLVNNAGVAGIIGP
TPWQTREDFQRVLNVNTLGPIGVTLALLPLLLQARGRVINITSVLGRLAANGGGYCVSKF
GLEAFSDSLRRDVAPFGVRVSIVEPGFFRTPVTNLETLEDTLQACWARLPPATQALYGEA
FLTKYLRVQQRIMNMICDPDLAKVSRCLEHALTARHPRTRYSPGWDAKLLWLPASYLPAS
LVDAVLTWVLPKPAQTVY
NT seq 957 nt   +upstreamnt  +downstreamnt
atgtggctgcctctgctgctgggtgtcttgctctgggcagcactgtggttgctcagggac
cggcagtgcctgccggccagcgatgcttttatcttcatcaccggctgtgactcgggcttt
gggcggctccttgctctgaggctggaccagagaggcttccgagtcctggccagctgcctg
acaccctcgggggcggaggacctccagcgggtcgcctcctcccgcctccacaccaccctg
ctggatgtcacagatccccagagcgtccggcaggcagccaagtgggtggaaacgcatgtt
gggaaaacagggctgtttggtctggtgaataatgctggtgtggctggcatcattgggccc
accccatggcagacgcgggaggacttccagcgggtgctgaatgtgaacacgctgggtccc
atcggggtcaccctcgctctgctgcccctgctgctgcaggcccggggccgagtgatcaac
atcaccagtgtccttggccgcctggcagccaatggagggggctactgcgtctccaagttt
ggcctggaggccttctctgacagcctgaggcgagacgtggctccttttggggtacgggtc
tctatcgtggaacctggcttcttccgaacccctgtgacaaacctggaaactctggaggac
accctgcaggcctgctgggcacggctgcctccagccacacaggccctctatggggaggcc
ttcctcaccaaatacctgagagtgcagcagcgcatcatgaacatgatctgtgacccggac
ctggccaaggtgagcaggtgcctggagcacgccctaactgcccgccaccccagaacccgc
tacagcccaggctgggatgccaagctgctctggttgccagcctcctacttgccagccagc
ctggtggatgctgtgctcacctgggtccttcccaagcctgcccagacggtctactaa

DBGET integrated database retrieval system