KEGG   Capra hircus (goat): 102181161Help
Entry
102181161         CDS       T02910                                 

Gene name
CACNG5
Definition
(RefSeq) calcium voltage-gated channel auxiliary subunit gamma 5
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
chx  Capra hircus (goat)
Pathway
chx04010  MAPK signaling pathway
chx04260  Cardiac muscle contraction
chx04261  Adrenergic signaling in cardiomyocytes
chx04921  Oxytocin signaling pathway
chx05410  Hypertrophic cardiomyopathy (HCM)
chx05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
chx05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102181161 (CACNG5)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102181161 (CACNG5)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102181161 (CACNG5)
   04261 Adrenergic signaling in cardiomyocytes
    102181161 (CACNG5)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    102181161 (CACNG5)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    102181161 (CACNG5)
   05414 Dilated cardiomyopathy (DCM)
    102181161 (CACNG5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:chx04040]
    102181161 (CACNG5)
Ion channels [BR:chx04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102181161 (CACNG5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 DUF716 Claudin_3 DUF373
Motif
Other DBs
NCBI-GeneID: 102181161
NCBI-ProteinID: XP_017919463
UniProt: A0A452EXY3
Position
19
AA seq 275 aa AA seqDB search
MGACGRKALTLLSSVFAVCGLGLLGIAVSTDYWLYLEEGVVLAQNQSTEARMSLHSGLWR
VCFLAGEEQGRCFTIEYVMPASTQLTSESTVSVLKMIRSATPFPLVSLFFMFIGFILSNI
GHVRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEMLNRTRDAETYFSYKYGWSFA
FAAISFLLTESAGVMSVYLFMKRYTAEDLYRPHPGFYRPRLSNCSDYSGQFLHPDAWARG
RSPSDLSSDASLQMNSSYPALLKCPDYDQLSTSPC
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcctgtgggaggaaggccctgaccctgctgagcagcgtcttcgccgtgtgcggc
ctgggcctgctgggcatcgccgtcagcacggactactggctgtacctggaggagggcgtg
gtcctggcccagaaccagagcaccgaggccaggatgtcgctgcactcaggcctgtggagg
gtctgcttcctggcaggtgaggagcaggggcgttgcttcaccatcgagtacgtgatgccc
gcgagcacccagctcacctcggagtccacggtcagcgtactaaaaatgattcgctcggcc
accccgttccccctggtcagcctcttcttcatgttcatcggcttcatcctgagcaacatt
gggcacgtccgtccccacaggacgatcctggccttcgtctcaggcatcttcttcatcctc
tcgggcctctccctcgtggtgggcctggtgctctacatctccagcatcaacgacgagatg
ctcaacaggaccagggacgcggagacctacttcagctacaagtacggctggtccttcgcc
ttcgcagccatctccttcctgctaacggagagcgccggggtgatgtccgtgtacctgttc
atgaagaggtacacagccgaggacctctaccggcctcaccccggcttctaccgcccgcgt
ctgagcaactgctcagattactcgggccagttcctgcacccggacgcctgggcccggggc
cgcagcccctccgacctctccagcgacgcctccctgcagatgaacagcagctacccggcg
ctgctcaagtgcccggactacgaccagctgtccacctccccgtgctga

DBGET integrated database retrieval system