KEGG   Capra hircus (goat): 102183639
Entry
102183639         CDS       T02910                                 

Gene name
AHRR
Definition
(RefSeq) aryl-hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
chx  Capra hircus (goat)
Brite
KEGG Orthology (KO) [BR:chx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:chx03000]
    102183639 (AHRR)
Transcription factors [BR:chx03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102183639 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9
Other DBs
NCBI-GeneID: 102183639
NCBI-ProteinID: XP_017921287
UniProt: A0A452DXN3
Position
20
AA seq 698 aa
MIPPGECLYAGRKRRKPVQKQRPAVGAEKSNPSKRHRDRLNAELDHLASLLPLPPDIISK
LDKLSVLRLSVSYLRVKSFFQALQERCPRQLVAAAPSPGDRGPRRGSAGSAVLEGRLLLE
SLHGFALVVSAEGMIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFRRQLHWAMDP
PQAGCGQPLLSETGEDAVLGRLLRAQEGGADPPTEYSAFLTRSFVCRVRCLLDSTSGFLT
MQFQGRLKFLFGQNRRAPSGVALPPRLALFCVAAPLALPPGVEVRMKTVYLRAKHRADVP
ASTDAKAKAASRLCESELLGNPNYSAGRSNGENGLSLFRAPEDACRWGRLTARGPCLCLR
GGPDLVLGLEGTAGAGEGEELGGLPRDAPPYSCRLEPLGPVKHPDWAAGRHSQDSGSAKR
KLEPGKADPFPAAPARGACLPYPGAQGAVHSLRSAPSSHPPRPPPGACAGRTSRALRDGH
QGPAPPPTPGPFPQGGLDSRVPRPALQHLPVGGYPAEDKLRGLLMPPGAPSHPTLSLDVP
IKMESDSGSEDAADGYCVSPAQVWLGASNPAKRQLATFPTKMHLKTEPGARQPLYSPPPG
PGLLGAPPRPGRGLAPLHPVSCACLEPPPPPRLCVRSHQPPNLGCNCRAPGPAPAVKLEP
LDSPLWAAHGQGGPPGLFSKSAPAAGMPPRDAQCAFLP
NT seq 2097 nt   +upstreamnt  +downstreamnt
atgatcccaccgggggagtgcctatatgccgggaggaaacgcaggaagcctgttcagaaa
cagaggcccgccgtgggcgctgagaagtcgaacccttccaagcggcaccgggaccgcctg
aatgctgagctggaccacctggccagcctgctgccactgccgcccgatatcatctctaag
ctcgacaagctttccgtcctgcgtctcagcgtcagctatctcagggtgaagagcttcttc
caagccctgcaggagaggtgcccaaggcagctggtggctgctgccccgtcgccgggagac
cggggtccacgcagagggtctgcaggctcggctgtgctggagggaaggctgctgctggag
tccctccacggcttcgctctggtggtgagcgcggaagggatgatcttctacgcgtcagcc
acgatcgtggactacctgggcttccaccagacggacgtgatgcaccagaatatttacgac
tacatccacgtggatgaccgccaggacttccgccggcagctgcactgggccatggaccct
cctcaggcagggtgcgggcagcccctgctctcggagacaggagaggatgcggtcctgggg
aggctgctccgggcccaggaagggggcgcagacccgcccaccgagtactcggccttcctg
acgcgctccttcgtctgccgtgtgcgctgcctgctggacagcacctcgggcttcctgacg
atgcagtttcaaggacgactgaagttcctcttcggacagaacaggcgggcgccctccggc
gtggccctgcccccacggctggccctgttctgcgtggcggcccctctggccctgcccccc
ggcgtggaggtgaggatgaagaccgtgtacctgagggcgaagcacagggcggacgtcccg
gcctcaaccgacgcaaaagcaaaagctgcctcacgtctctgcgaatcagaattgctcgga
aaccccaattactcagcagggagaagcaacggagaaaatggcctctccttgttcagggcg
ccagaggacgcctgccgctggggccggctcacagcccggggcccctgcctgtgcctccgg
ggaggccctgaccttgtccttggcctcgagggcaccgcaggggccggggaaggagaggag
ctcggggggctcccgcgggatgcgcccccgtacagctgccgcctagagcccctgggccct
gtgaagcacccggactgggctgctgggaggcacagtcaggacagcggcagcgccaagcgg
aagctggagcccggcaaggccgacccgttccccgccgccccggcccgcggtgcctgcttg
ccctacccgggtgcgcagggcgccgtccactccctccggagcgcacccagctcacacccg
cccaggccgcccccgggggcctgcgccggccggaccagcagagccctgagggacgggcac
cagggcccagcgccgccccccacccccggccccttcccccaggggggcctggacagcagg
gtccctcggccggcactccagcatctcccggtgggcggctaccctgctgaggacaagctg
cgaggccttctgatgcccccgggagccccgagtcaccccacgctgtcgctcgacgtgccc
atcaagatggagagtgactcggggtccgaggatgcagcggatggctactgcgtgtcccca
gcccaggtgtggctgggggccagcaacccagccaagagacagctggccaccttcccaacc
aagatgcacctgaagacggagccaggcgccaggcagcccctgtacagcccacccccaggc
cctggcctgctgggtgccccgcccagacccggcagggggctggccccgctgcaccccgtg
tcctgtgcctgcctggagcccccgcccccgccccgcctctgtgtgcggagccaccagccc
cccaacctgggctgcaactgccgggctcccgggccagctcccgcagtcaagctcgagccc
ctggactcgcccctgtgggcagctcacggccagggcgggccgcctgggctgttctccaag
agcgccccggccgcagggatgccccccagggacgcgcagtgcgccttcctgccctag

DBGET integrated database retrieval system