KEGG   Capra hircus (goat): 102185469
Entry
102185469         CDS       T02910                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
chx  Capra hircus (goat)
Pathway
chx00230  Purine metabolism
chx01100  Metabolic pathways
chx01522  Endocrine resistance
chx04015  Rap1 signaling pathway
chx04020  Calcium signaling pathway
chx04022  cGMP-PKG signaling pathway
chx04024  cAMP signaling pathway
chx04062  Chemokine signaling pathway
chx04072  Phospholipase D signaling pathway
chx04114  Oocyte meiosis
chx04211  Longevity regulating pathway
chx04213  Longevity regulating pathway - multiple species
chx04261  Adrenergic signaling in cardiomyocytes
chx04270  Vascular smooth muscle contraction
chx04371  Apelin signaling pathway
chx04540  Gap junction
chx04611  Platelet activation
chx04713  Circadian entrainment
chx04714  Thermogenesis
chx04723  Retrograde endocannabinoid signaling
chx04724  Glutamatergic synapse
chx04725  Cholinergic synapse
chx04727  GABAergic synapse
chx04742  Taste transduction
chx04750  Inflammatory mediator regulation of TRP channels
chx04911  Insulin secretion
chx04912  GnRH signaling pathway
chx04913  Ovarian steroidogenesis
chx04914  Progesterone-mediated oocyte maturation
chx04915  Estrogen signaling pathway
chx04916  Melanogenesis
chx04918  Thyroid hormone synthesis
chx04921  Oxytocin signaling pathway
chx04923  Regulation of lipolysis in adipocytes
chx04925  Aldosterone synthesis and secretion
chx04926  Relaxin signaling pathway
chx04927  Cortisol synthesis and secretion
chx04928  Parathyroid hormone synthesis, secretion and action
chx04934  Cushing syndrome
chx04935  Growth hormone synthesis, secretion and action
chx04970  Salivary secretion
chx04971  Gastric acid secretion
chx04972  Pancreatic secretion
chx04976  Bile secretion
chx05032  Morphine addiction
chx05163  Human cytomegalovirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05200  Pathways in cancer
chx05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102185469 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102185469 (ADCY4)
   04371 Apelin signaling pathway
    102185469 (ADCY4)
   04020 Calcium signaling pathway
    102185469 (ADCY4)
   04072 Phospholipase D signaling pathway
    102185469 (ADCY4)
   04024 cAMP signaling pathway
    102185469 (ADCY4)
   04022 cGMP-PKG signaling pathway
    102185469 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102185469 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102185469 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102185469 (ADCY4)
   04062 Chemokine signaling pathway
    102185469 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    102185469 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    102185469 (ADCY4)
   04912 GnRH signaling pathway
    102185469 (ADCY4)
   04913 Ovarian steroidogenesis
    102185469 (ADCY4)
   04915 Estrogen signaling pathway
    102185469 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    102185469 (ADCY4)
   04921 Oxytocin signaling pathway
    102185469 (ADCY4)
   04926 Relaxin signaling pathway
    102185469 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    102185469 (ADCY4)
   04918 Thyroid hormone synthesis
    102185469 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    102185469 (ADCY4)
   04916 Melanogenesis
    102185469 (ADCY4)
   04925 Aldosterone synthesis and secretion
    102185469 (ADCY4)
   04927 Cortisol synthesis and secretion
    102185469 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102185469 (ADCY4)
   04270 Vascular smooth muscle contraction
    102185469 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    102185469 (ADCY4)
   04971 Gastric acid secretion
    102185469 (ADCY4)
   04972 Pancreatic secretion
    102185469 (ADCY4)
   04976 Bile secretion
    102185469 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    102185469 (ADCY4)
   04727 GABAergic synapse
    102185469 (ADCY4)
   04725 Cholinergic synapse
    102185469 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    102185469 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    102185469 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    102185469 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    102185469 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    102185469 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102185469 (ADCY4)
   04714 Thermogenesis
    102185469 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102185469 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    102185469 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    102185469 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102185469 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102185469 (ADCY4)
   05163 Human cytomegalovirus infection
    102185469 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102185469 (ADCY4)
Enzymes [BR:chx01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102185469 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Other DBs
NCBI-GeneID: 102185469
NCBI-ProteinID: XP_017910123
UniProt: A0A452FG15
Position
10
AA seq 1077 aa
MARLFSPRQPPSEDLFYETYYSLSQQYPLLLLLLLIVLLGLLALFPVAWASGRELAADPA
FLTTVLCALGGFSLLLVLASREQRLQRWTRPLSGLVWAALLALGHSFLFTGGVVSAWDQV
SFFLFVIFTVYAMLPLDMRDAITAGVTTSFLHLLVLGLYLGPQPDSRPALLPQLAANAVL
FLCGNAAGAYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAREMK
EEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEASGVPGRVHITGATLALLAG
AYAVEDAAMEHRDPYLRELGEPTYLVIDPWAAEEDEKGTAGGLLSSLEGPKMRPSLLMTR
YLESWGAAKPFAHLSHVESPVSTSTPLPEKSLSSFSPQWSLDRSRTMRALDEELDTGDAK
FFQVIEQLNSQKQWKQSKDFNPLTLYFREKEMEKEYRLSALPAFKYYAACTFLVFLSNFI
IQMLVTNRPPALTITYSITFLLFFLLLFVCFSEHLMKCVLKGPKMLHWLPTLSVLVATRP
GLRVALGTATILLVFVMAITSLVFLPAASACPFQAPNVSSMASNLSWEIPGSLPLISVPY
SMHCCVLGFLSCSLFLHMSFELKLLLLLLWLTASCSIFLHSHAWLSDCLIARLYLGTLDS
RPGVLKEPKLMGAASFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEQEETETMENLTRL
LLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESSINHEGLECLR
LLNEIIADFDELLSKPKFSGVEKIKTICSTYMAATGLNAASGQDAQQDAEQSCGHLGTMV
EFAVALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMEST
GVLGKIQVTEETARALQSLGYTCYSRGIIKVKGKGQLCTYFLNTDLTRTGPPSATLG
NT seq 3234 nt   +upstreamnt  +downstreamnt
atggcccgcctcttcagtccccggcagccccccagcgaagacctcttctacgagacctac
tacagcctgagccagcagtacccactgctgctgctgctgctgctgatcgtgctcttgggg
ctcctggcgctgttccctgtggcctgggcaagtggcagggagctggccgcagacccagcc
ttcctgaccactgtgctctgcgctctgggcggcttctcactgctgctggtcctggcttcc
cgggagcagcgactgcagcgctggacgcgtcccctgtcaggcctcgtgtgggcagcactg
ctcgcactgggccacagcttcctgttcactgggggcgtggtgagcgcctgggaccaggtg
tcctttttcctttttgtcatcttcactgtgtatgccatgttgcccttggacatgagggac
gccatcaccgcgggggtcaccacctcattcttgcacctgctggtccttgggctgtatctt
gggcctcagcccgactctcggccggcgctgctgccacagctggctgcaaacgcggtgctg
ttcctgtgcgggaacgcggccggagcctatcacaaggcgctgatggagcgcgcgctgcgc
gccacgttccgggaggcgcttagctccctgcactcgcggcggagactggacaccgagaag
aagcatcaggaacaccttctcttgtccatccttcctgcctacctggcccgagagatgaag
gaggagatcatggcccgactgcaggctggacaggggtcacggccagagagcaccaacaac
ttccacagcctctatgtcaagaggcaccagggagtcagcgtgctgtatgctgacatcgtg
ggcttcacgcgactggccagtgagtgctcccctaaggagttggtgcttatgctcaacgag
ctctttggcaagttcgaccaaatcgccaaggagcacgaatgcatgcggatcaagatcctg
ggagactgttactactgtgtctctgggctgccgctctccctgccagaccacgccatcaat
tgtgtgcgcatggggctggacatgtgccgggccatcaggaaacttcgggcagccacgggc
gtggatatcaacatgcgtgtgggcgtgcactcaggcagcgtgctctgcggggttatcggg
ctacagaaatggcagtatgatgtctggtcccatgacgtcactctagccaaccacatggag
gcgagtggagtgccagggcgagtacatatcacaggggccacgctggccctgctggccggg
gcttatgctgtggaggatgcagccatggagcaccgggacccataccttcgggagctaggg
gagccgacctacctggtcatcgacccctgggctgcagaggaggacgagaagggcactgca
ggagggttgctgtcctctctggagggccccaagatgcgtccgtccctgctgatgacccgc
tacctggagtcctggggtgcagccaagcctttcgcccacctgagccatgtagagagccct
gtgtccacgtctacccctctcccggagaagtccctgtcttccttcagcccccagtggagc
ctggaccggagccgtaccatgcgggcacttgacgaggaactagacactggggatgccaag
ttcttccaggtcatcgaacagctcaattctcagaaacagtggaaacagtcaaaggacttc
aatccactgacactgtacttcagagagaaggagatggagaaagagtatcggctctctgca
ctccccgccttcaaatactatgcagcctgcaccttcctggtttttctctccaacttcatt
atccagatgctggtgaccaacaggcctccagctctgaccatcacctatagcatcaccttc
ctcctcttcttcctcctcctcttcgtctgcttctcagagcacctgatgaagtgtgtcttg
aaaggccccaagatgctgcactggctacccaccctgtctgtcctggtggccacacggcca
ggactgcgagtggctctgggcaccgctaccatcctgctcgtcttcgtcatggccattacc
agtctggtcttcttaccagcagcatcagcctgccctttccaggctcccaatgtatcctcc
atggcttccaacctctcctgggagatccctgggtccctgcctctcatcagcgtgccctac
tccatgcattgctgcgtgttggggttcctctcctgctccctcttcctgcacatgagcttt
gagctgaagctgctgctgcttctgctgtggctgacggcctcctgctccatcttcctgcac
tcccatgcctggttgtccgactgcctcatcgcccgcctctacctgggcaccttggactcc
aggccaggggtgctgaaggagcccaaactgatgggagcagcctccttcttcatcttcttc
ttcaccctcctagtcctggctcggcagaacgaatattactgccgcctggactttctgtgg
aagaagaagctgaggcaagagcaggaggagacagagacgatggagaacctgactcggctg
ctcttggagaacgtgctccctgcccacgtggccccccagtttattggtcagaatcggcgc
aatgaggacctctaccaccagtcctatgagtgtgtgtgtgtcctcttcgcctcggtccca
gactttaaggagttctactctgagtccagcatcaaccatgaggggctagagtgtctgcgg
ctgctcaatgaaataatcgctgattttgatgagctgctctccaagcccaagttcagtggg
gtggagaagatcaaaaccatctgcagcacctacatggcagctaccggcttgaacgccgcc
tcgggacaggatgcacagcaggatgctgagcagagctgcggccaccttggcaccatggta
gagtttgctgtggcccttgggtctaagctggatgtcatcaacaagcactcattcaacaac
ttccgcctgcgtgtagggttaaaccacggacctgtagtggctggagtgattggggcccag
aaaccacaatatgatatctggggcaacacggtgaacgtggccagccgcatggagagcaca
ggcgtcctgggaaaaattcaggtaacagaagagacagcccgggccctgcagtccttaggc
tacacctgctacagccggggcatcatcaaggtcaaaggcaaagggcagctctgcacctac
ttcttgaacacagacttaacacgaactggacctccctcagccaccctaggctga

DBGET integrated database retrieval system