KEGG   Capra hircus (goat): 102185628Help
Entry
102185628         CDS       T02910                                 

Gene name
ERLIN2
Definition
(RefSeq) ER lipid raft associated 2
  KO
K23341  erlin
Organism
chx  Capra hircus (goat)
Brite
KEGG Orthology (KO) [BR:chx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:chx04121]
    102185628 (ERLIN2)
Ubiquitin system [BR:chx04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ERAD complex
    102185628 (ERLIN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7 DUF4346 RapA_C POR_N
Motif
Other DBs
NCBI-GeneID: 102185628
NCBI-ProteinID: XP_005698880
UniProt: A0A452G6G9
Position
27
AA seq 338 aa AA seqDB search
MAQLGAVVAVAASFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK
SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPHAVYDIVKNYTADYDKALIFNKI
HHELNQFCSVHTLQEVYIELFDQIDENLKLALQQDLTSMAPGLVIQAVRVTKPNIPEAIR
RNYELMESEKTKLLIAAQKQKVVEKEAETERKKALIEAEKVAQVAEITFGQKVMEKETEK
RISEIEDAAFLAREKAKADAECYTAMKIAEANKLKLTPEYLQLMKYKAIASNSKIYFGKD
IPNMFMDSAGGVGKQFEGLADKLSFGLEDEPVEADSEN
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggctcagttgggagcggttgtggctgtggctgccagtttcttttgtgcatctctcttc
tcggcggtgcacaagatagaagagggacatattggggtgtattacagaggtggcgccctg
ctgacttccaccagcggccctggcttccatctcatgcttcctttcatcacatcatataag
tctgtgcagaccacactccagacagatgaggtgaagaatgtaccttgtgggacaagcggt
ggtgtgatgatctacttcgacagaattgaggtggtgaacttcctggtcccacacgcagtg
tatgacatagtgaagaactacacagccgactacgacaaggcactcatcttcaacaagatc
caccacgagctgaaccagttctgcagtgtccacacgcttcaggaggtctacatcgagctc
ttcgatcagattgatgaaaatctcaaactggctctgcagcaagacctgacctccatggcc
cctgggctcgtcatccaagctgtgcgggtaacaaagcccaacatcccagaagccatccgc
aggaactacgagctgatggaaagcgagaagacgaagctcctgatcgcagcccagaagcag
aaggtggtggagaaggaagccgagacagagcggaagaaggccctcatcgaggcagagaag
gtggcgcaggtggccgaaatcacctttgggcagaaggtgatggagaaggagacggagaag
aggatctcggagatcgaagatgctgcgttcctggcccgggagaaggccaaggctgacgct
gagtgctacactgccatgaaaatagccgaagcaaataagctgaagctgacccctgagtat
ctgcagctgatgaagtacaaggccattgcttccaacagcaagatttactttggcaaagac
atccctaacatgttcatggactctgcgggcggcgtgggcaagcagtttgagggactagct
gacaagctgagctttggcttggaagatgagcccgtggaggcagactccgagaactga

DBGET integrated database retrieval system