KEGG   Capra hircus (goat): 102185724Help
Entry
102185724         CDS       T02910                                 

Gene name
CACNA1I
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 I
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
chx  Capra hircus (goat)
Pathway
chx04010  MAPK signaling pathway
chx04020  Calcium signaling pathway
chx04713  Circadian entrainment
chx04925  Aldosterone synthesis and secretion
chx04927  Cortisol synthesis and secretion
chx04929  GnRH secretion
chx04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102185724 (CACNA1I)
   04020 Calcium signaling pathway
    102185724 (CACNA1I)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    102185724 (CACNA1I)
   04925 Aldosterone synthesis and secretion
    102185724 (CACNA1I)
   04927 Cortisol synthesis and secretion
    102185724 (CACNA1I)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102185724 (CACNA1I)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102185724 (CACNA1I)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:chx04040]
    102185724 (CACNA1I)
Ion channels [BR:chx04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102185724 (CACNA1I)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel
Motif
Other DBs
NCBI-GeneID: 102185724
NCBI-ProteinID: XP_017904284
Position
5
AA seq 2192 aa AA seqDB search
MAENSPPPPSPAAAPVAEPGVTEQXGPQSPPPSPPGPEEPMDGVDPEVPHPDLAPVAFFC
LRQTTSPRNWCIKMVCNPWFECISMLVILLNCVTLGMYQPCDDMDCLSERCKILQVFDDF
IFVFFAMEMVLKMVALGIFGKKCYLGDTWNRLDFFIVMAGMVEYSLDLQNINLSAIRTVR
VLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAGLLRNRCFL
EENFTIQGDVALPPYYQPEEDDEMPFICSLSGDNGIMGCHEIPPLKEQGRECCLSKDDVY
DFGAGRQDLNASGLCVNWNRYYNVCRTGSANPHKGAINFDNIGYAWIVIFQVITLEGWVE
IMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQREHRLMLEQRQRYLS
SSTVASYAEPGDCYEEIFQYVCHILRKAKRRALGLYHALRSRRQAPGTPGSATPGPGAKE
PRHYKLCPRHSPLDPTPHTLVQPVSAMLASDPDSCPCCQHDTGRWPSGPGSSSDSGQEGS
GSAHAGVGEGEAGMDVARTSEDGASSELGKEDEEGPADGAARLCEDLWRETRAKLRGIVD
SKYFNRGIMMAILVNTVSMGIEHHQQPEELTNILEICNVVFTSMFALEMLLKLAAFGLFD
YLRNPYNIFDSIIVIISIWEIVGQADGGLSVLRTFRLLRVLKLVRFMPALRRQLVVLMKT
MDNVATFCMLLMLFIFIFSILGMHIFGCKFSLRTDTGDTVPDRKNFDSLLWAIVTVFQIL
TQEDWNVVLYNGMASTSPWASLYFVALMTFGNYVLFNLLVAILVEGFQAEGDANRSYSDE
DQSSSNMEEFDKLQEGLDCSGDPKLCPIPMTPNGHLDPNLPLGGHLGPTGAAASAPRLSL
QPDPVLMALGSRKSSVMSLGRVSYDQRSLSSSRSSYYGPWGRSGAWASRRSSWNSLKHKQ
PSAEHESLLSAERGGARGCEGARDEGPLRTAPLHALHAHHAHHGPHPVHRHRHHRRTLSL
DTRDSVDLAELVPTVGTHSRAAWRTAGLTPGHEDCNGRMPSIAKDVFTKMDDRRDRGEDE
EEIDYTLCFRVRKMIDVYKPDWCEVREDWSVYLFSPENRFRVLCQTIIAHKLFDYVVLAF
IFLNCITIALERPQIEAGSTERIFLTVSNYIFTAIFVGEMTLKVVSLGLYFGEQAYLRSS
WNVLDGFLVFVSIIDIVVSVASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETL
ISSLKPIGNIVLICCAFFIIFGILGVQLFKGKFYHCLGVDTRNITNRSDCVAANYRWVHH
KYNFDNLGQALMSLFVLASKDGWVNIMYNGLDAVAVDQQPVPNHNPWMLLYFISFLLIVS
FFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLEKKRRKAQRLPYYATYCPTRLL
IHSMCTSHYLDIFITFIICLNVVTMSLEHYNQPTSLETALKYCNYMFTTVFVLEAVLKLV
AFGLRRFFKDRWNQLDLAIVLLSVMGITLEEIEINAALPINPTIIRIMRVLRIARVLKLL
KMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLVCNDENPCEGMSRHA
TFENFGMAFLTLFQVSTGDNWNGIMKDTLRDCTHDERSCLSSLQFVSPLYFVSFVLTAQF
VLINVVVAVLMKHLDDSNKEAQEDAEMDAELELELAHGLGPSPRPPAGAPGAPTPAHGPG
GAAGEGDPEGCLRRSCYSPAQENLWLDSVSLIIKDSLEGELTIIDNLSGSIFHHYSSPAG
CEKCHHDKQEVQLAETEAFSLNSDRSSSILLGDDLSLEDPAACPVGPRDGKGEPDPPEPM
RVGDLGECFFPLPNTAVSSGPENFLCEMEAIPFNPVRSWLKHEGSQAPPSPFSPDASSPL
LPMPAEFFHPAVAASQEGQEKGARAGTLPKIALQGSWASLRSPSVNCTLLRQATGSDTSL
EVSRSSSAGSLQTTLEDSLTLSDSPRRGLGPPASVLGPRSGPSPAARRRPSSRGRGPFSL
RGLRAHQRSHSSGGSTSPGCTRHDSMDPSDEEGAGGRAGGGGGGAGSEHSETLSSLSLTS
LFGPPPPPPGLRPARRFSSASSLAAGPGRPRATAAGPRGLARSPSWAAADRCKDPPRPAE
SAVPRDPEAPEPQPPSPLGQQPSGDAASQGKR
NT seq 6579 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaactccccaccgcccccttcccccgctgcagccccggtggctgaacccgga
gtcacggagcagncggggccccagagcccccctccctcccctcctggcccagaagagccc
atggacggagttgacccagaagtccctcacccggacctggcccccgttgccttcttctgc
ctgcgacagaccaccagcccccggaactggtgcatcaagatggtgtgtaacccgtggttt
gaatgtatcagcatgctggtgatcctgctgaactgcgtgaccctcggcatgtaccagccg
tgcgacgacatggattgcctgtcagagcgctgcaagatcctgcaggtctttgacgacttc
atctttgtcttctttgccatggagatggtgctcaagatggtggccctgggcatttttggc
aagaagtgctaccttggggacacatggaaccgactggatttcttcattgtcatggcaggg
atggtcgagtactccctggacctccagaacatcaacctgtcggccatccgtaccgtgcgc
gtcctgaggcccctcaaagccatcaaccgtgtgcccagtatgcggatcctggtgaacctg
ctcctggacacactgcccatgctggggaatgtcctcctgctttgcttctttgtcttcttc
atctttggcatcatcggcgtgcagctctgggccggcctgcttcgcaaccgctgcttcctg
gaggagaacttcaccatacaaggggacgtggctctgcccccctactaccagccggaggag
gacgacgagatgcccttcatctgctccctgtcgggggacaacggcatcatgggctgccac
gagatccctccgctcaaggagcagggccgcgagtgctgcctgtccaaggacgacgtctac
gacttcggggcgggccgccaggacctcaacgccagtgggctctgcgtcaactggaaccgc
tactacaacgtgtgccgcacgggcagcgccaacccccacaagggcgccatcaactttgac
aacatcggctatgcctggatagtcattttccaggtgatcactctggaaggctgggtggag
atcatgtactatgtgatggatgctcactctttctacaacttcatctatttcatcctgctc
atcatcgtgggctccttcttcatgatcaacctgtgcctcgttgtcatagcgacccagttc
tcggagaccaagcagcgggagcaccggctgatgctggagcagcggcagcgctacctgtcc
tccagcacggtggccagctacgctgagcccggcgactgctacgaggagatcttccagtac
gtctgccacatcctgcgcaaggccaagcgccgcgccctgggcctctaccacgccctgagg
agccggcgccaggccccggggacgcccggctccgccacgcccgggcccggcgccaaggag
cccaggcactacaagttatgcccccgacacagccccctggacccgacgccccacacgctg
gtgcagcccgtctccgccatgctggcctccgaccctgacagctgcccctgctgccagcac
gacaccggccggtggccctcaggcccgggcagcagcagcgactcaggccaggagggctcg
ggctccgcgcacgcgggggtcggcgagggtgaagccggcatggatgtggcccgcaccagc
gaggacggggcctcctcggagctggggaaggaggatgaggaggggccggccgatggggcg
gcccggctgtgcgaagacctgtggcgggagacgcgagccaagctgcggggcatcgtggac
agcaagtacttcaaccggggcatcatgatggctattctggtcaacaccgtcagcatgggc
atcgagcaccatcagcagcctgaggagctgaccaacatcctggagatctgcaatgtggtc
ttcaccagcatgtttgccctggagatgctgctgaagctggctgccttcgggctcttcgac
tacctgcgcaacccctacaacatcttcgacagcatcattgtcatcatcagcatctgggag
atcgtggggcaggcggacggcgggctgtcggtgctgcggactttccggctgctgcgggtg
ctgaagctggtgcgctttatgcccgcgctgcggcgccagctcgtggtgctcatgaagacc
atggacaacgtggccaccttctgcatgctgctcatgctcttcatcttcatcttcagcatc
cttgggatgcacatctttggctgcaaattcagcctgcgcacggacacaggagacacggtc
cctgacaggaagaacttcgactccctgctgtgggccatcgtcacggtgttccagatcctc
acccaggaggactggaacgtcgtcctctacaacggcatggcttccacctccccctgggcc
tccctctacttcgttgccctcatgaccttcggcaactatgtgctcttcaacttgctggta
gccatcctggtggagggcttccaggcggagggtgatgccaatcgctcctactcggacgag
gaccagagctcatccaacatggaggagtttgacaagctccaggagggcctggactgcagc
ggagatcccaagctctgcccaatccccatgacccccaatgggcacttggaccccaatctc
ccactgggtggacatctgggccccactggggctgcagcatccgccccccgcctctcactg
cagccagaccccgtgctaatggccctgggctcccgcaagagcagtgtcatgtcactgggg
agggtgagctacgaccagcgctccctgtccagctctcggagctcctactacgggccgtgg
ggccgcagcggggcctgggccagccgtcgctccagctggaacagcctcaagcacaagcaa
ccgtcggcggagcatgagtccctgctctccgctgagcgtggcggcgcccggggctgcgag
ggtgcccgggacgaaggcccgctacggaccgcgcccctgcacgccctacacgcccaccat
gcacatcatggtccccacccggtgcatcgtcaccgccaccaccgccgaacactgtccctc
gacaccagagattcggtggacctggccgagctagtgcccaccgtgggcacccactcccgg
gcggcctggaggacggcgggcctgacccccgggcacgaggactgcaatggcaggatgccc
agcatcgccaaggacgtcttcaccaagatggatgaccgccgggatcgcggggaggatgag
gaggagattgactacactctgtgcttccgagtccgcaagatgattgacgtctacaagcct
gactggtgtgaagtccgcgaggactggtccgtctacctcttctcccccgagaacaggttc
cgggtcctgtgtcagaccatcattgcccacaagctctttgactatgtcgtcctggccttc
atcttcctcaactgcatcaccatcgccctggagcggccccagattgaggctggcagcacc
gaacgcatcttcctcactgtgtccaactacatcttcacagctatcttcgtgggcgagatg
accctgaaggtggtctcgctgggcctgtacttcggggaacaggcgtacctgcgcagcagc
tggaatgtactggacggcttccttgtcttcgtgtcaatcattgacattgtggtgtccgtg
gcctcggctgggggagccaagatccttggcgtcctccgggtcctacggctcctgcgcacc
ctacggcccctgcgtgtcattagccgggcacctggcctgaagctggtggtggagacactc
atctcctccctaaagcccatcggcaacatcgtcctcatctgctgcgccttcttcatcatc
ttcggcatcctgggggtgcagctcttcaagggcaagttctaccactgtctgggtgtagac
acccgcaacatcaccaaccgctccgactgcgtggctgccaactaccgctgggtccatcac
aagtacaacttcgacaatctgggccaggccctcatgtccctctttgtgctggcctccaag
gatggctgggtgaacattatgtacaatggactggacgccgtcgcagtggaccagcagccc
gtgcccaaccacaacccctggatgctgctctacttcatctccttcctgctcatcgtcagc
ttcttcgtgctcaacatgttcgtgggcgtcgtggtggagaacttccacaagtgccggcag
caccaggaggccgaggaggcgcggcggcgcgaggagaagcggctgcggcggctggagaag
aagcgccggaaggcccagcggctgccctactatgctacctactgtcccacgaggctgctc
atccactccatgtgcaccagccactacctggacatcttcatcaccttcatcatctgcctc
aatgtggtcaccatgtccctggagcactacaaccagcccacgtctctggagacagccctc
aagtactgcaactacatgttcaccaccgtctttgtgctggaggctgtgctgaagctggtg
gcatttggtctgagacgcttcttcaaggaccggtggaaccagctggacctggccatcgtg
ctgctgtcggtcatgggcatcacgctggaggagattgagatcaacgcggcgctgcccatc
aaccccaccatcatccgaatcatgcgggtcctccgaatcgcccgggtgctgaagctcctg
aagatggccacgggaatgcgggccctgctggacaccgtggtgcaagctctgccccaggtg
ggcaacctgggcctcctcttcatgctgctcttcttcatctatgccgccctgggagtggag
ctcttcgggaagctggtctgcaatgatgagaacccttgtgagggcatgagccggcacgcc
accttcgagaacttcggcatggccttcctcacgctcttccaggtctccactggcgacaac
tggaacgggatcatgaaggacacgctgcgggactgcacgcacgatgagcgcagctgcctg
agcagcctgcagttcgtgtcaccgctgtacttcgtcagcttcgtgctcacggcccagttc
gtgctcatcaacgtggtggtggccgtgctcatgaagcacctggacgacagcaacaaggag
gcccaggaggacgccgagatggacgccgagctggagctggagctggcccatggcctgggc
cccagcccgcggccacccgccggagccccaggggcgcccacgcccgcccacgggccagga
ggggcggccggcgagggtgaccccgagggctgcctgcgccgaagctgctactcgccagcc
caggagaacctgtggctggacagcgtctctttaatcatcaaggactccttggagggggag
ctgaccatcatcgacaacctgtccgggtccatcttccaccactactcctcgccggccggc
tgcgagaagtgtcaccatgacaagcaggaggtgcagctggccgagacggaggccttctcc
ctgaactcagacaggtcctcgtccatcctgcttggcgatgacctgagtctggaggaccct
gcagcctgccccgtcggccccagggacggcaagggcgagcctgacccgcctgagcccatg
cgggtaggggacctgggcgaatgcttcttccccttacccaacacggccgtctcatcgggt
ccggagaacttcctgtgcgagatggaggccatcccattcaaccccgtccggtcctggctg
aaacacgagggcagccaagcacccccgagccctttctccccggatgcctccagcccactc
ctgcccatgccggccgagttcttccaccctgctgtggctgccagccaggaagggcaggag
aagggcgccagagccgggaccctccccaagatcgccctgcagggctcctgggcctccctg
cggtcgccgagcgtcaactgcaccctccttcgacaggccacggggagcgacacgtcgctg
gaggtcagccgcagcagctcggcgggcagcctgcagaccacgctggaggacagcctgacc
ctgagcgacagtccgcggcgagggctggggccgccggcgtcggtcctggggccccgctcc
ggcccgtcgcccgccgcgcgccgccgcccgagctcgcggggccggggcccgttcagcctg
cgcgggctgcgggcgcaccagcgcagccacagcagcgggggctccaccagcccgggctgc
acgcggcacgactccatggacccctcggatgaggagggcgcgggcggccgggccggcggg
ggcggcgggggcgcgggcagcgagcactcggagaccctcagcagcctctcgctcacctcc
ctcttcgggccgccgcccccgccgcccggcctccgccccgcgcgccggttcagcagcgcc
agcagcctggctgccgggcccggccgcccccgcgccaccgccgccgggccccgcggcctg
gcccgcagcccctcctgggccgccgccgatcgctgcaaggacccgccgcgcccggccgag
tcggccgtcccccgggacccggaggcccccgaaccgcagcccccgtcgccgctggggcag
cagccgtccggggacgccgcgagccaggggaagagatga

DBGET integrated database retrieval system