KEGG   Capra hircus (goat): 102185924
Entry
102185924         CDS       T02910                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchoring protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
chx  Capra hircus (goat)
Brite
KEGG Orthology (KO) [BR:chx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:chx01009]
    102185924 (AKAP5)
Protein phosphatases and associated proteins [BR:chx01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     102185924 (AKAP5)
SSDB
Motif
Pfam: WSK
Other DBs
NCBI-GeneID: 102185924
NCBI-ProteinID: XP_005686026
UniProt: A0A452E7F0
Position
10
AA seq 428 aa
MEITVSEIQVESKDETRSAEVRRQDERQEEKASMLCFKRRKKAAKAMKPEASSKAADATR
KCPPEAGASDQPQHPGGAWASIKRLVTRRKRSESSKQQKPFEAKLQSEINAEDANPSKKK
AKSRLKIPCIKFSKGEKRSNHSKIIEDSDCSVKVQEAENLVTKTLTQSDDQTTNSKSPRD
VREAVSQKGDDEVCESNVNNSITSPGEKVISVELELDMGHSAIQTGTLIPEKDTEMLEEK
QSTQPQQVSPLEASDTEQELPVGSEIPPSPAVPDQQILEEARNGVLESGPDWKEHGSREI
VVEESKPKDTELSQELDFQENEITAEKPKPEESKRMEPIAIIITDTEISEFDVKKSKNVP
KPFLISIENEQVGVFANDSGFEGRTSEQYETLLIETASSLVKNAIQLSIEQLVNEMASDD
NTINNRLQ
NT seq 1287 nt   +upstreamnt  +downstreamnt
atggagatcacagtttctgaaatacaagtagaaagcaaggatgagacgagatcagcagaa
gttagacgtcaggatgagaggcaggaggaaaaagcatcgatgctctgcttcaagagaaga
aaaaaagcagccaaagcaatgaagcccgaagccagctctaaagctgctgatgcaacaagg
aagtgtcctccagaagcaggagcttctgatcagccacagcaccctggcggggcctgggcc
tcaatcaaacgccttgtaacacgcaggaaaaggtcagagtcttcaaagcagcaaaagccc
tttgaggctaaactgcaatcggaaatcaatgctgaggatgctaatccttctaagaaaaag
gcaaaatccagactcaagattccctgcataaaattctcaaaaggagagaaaagaagtaat
cactccaaaatcatagaagattcagactgcagtgtcaaagtccaagaggctgaaaatctg
gttacaaaaactctgacccaatcagatgaccagacaacaaacagcaagtcgccccgggat
gtaagggaagctgtctcacagaaaggggatgatgaggtctgtgaatcaaatgtgaacaac
agcataacttctcctggagagaaagtgatttcagtagaacttgagttagatatgggtcat
tctgctattcaaacaggaactctaatccctgaaaaagatactgaaatgcttgaggaaaaa
caaagcactcaacctcagcaagtgagcccactggaagcttcggacacagaacaggagctc
ccagtgggttctgagattcctccctcgcctgcagtcccagatcaacaaattctggaagaa
gccagaaatggtgtcctagaaagtggaccagattggaaggagcatggaagtagagagatt
gttgttgaggagagtaagccaaaagatactgaattgagccaggaactggattttcaagaa
aatgagatcactgcagaaaaacccaaaccagaagaaagcaaaagaatggagccaattgct
attattatcacagacactgaaatcagtgaatttgatgttaagaaatctaaaaatgtccct
aagccattcttaatttcaattgaaaatgagcaagtaggggtttttgctaatgacagtggt
tttgagggtagaacttcggaacaatatgaaacactcttaatagaaacagcttcttctctt
gtcaagaatgctatccagttgtctatagaacagcttgttaatgaaatggcctctgatgat
aatacaataaataatcgtctacagtga

DBGET integrated database retrieval system