KEGG   Capra hircus (goat): 102187085Help
Entry
102187085         CDS       T02910                                 

Gene name
IP6K2
Definition
(RefSeq) inositol hexakisphosphate kinase 2
  KO
K07756  inositol-hexakisphosphate 5-kinase [EC:2.7.4.21]
Organism
chx  Capra hircus (goat)
Pathway
chx04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    102187085 (IP6K2)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.21  inositol-hexakisphosphate kinase
     102187085 (IP6K2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IPK
Motif
Other DBs
NCBI-GeneID: 102187085
NCBI-ProteinID: XP_005696042
Position
22
AA seq 425 aa AA seqDB search
MSPAFRAMDVEPRDKGILLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQFYETLPAEMR
KFTPQYKGVVSVSFEEDEDRNLCLIAHPLKGDHGTVDSVDNSDCEPKSKLLRWTNKKHHV
LETDKTSKDWVRQHRKEEKAKSHKLEEEFEWLKKSEVLYYSVEKKGNVSSQLKHYNPWSM
KCHQQQLQRMKENAKHRNQYKFILLENLTSRYEVPCVLDLKMGTRQHGDDASEEKAANQI
RKCQQSTSAVIGVRVCGMQVYQAGSGQLMFMNKYHGRKLSVQGFKEALFQFFHNGRYLRR
ELLGPVLRKLTELKGVLERQESYRFYSSSLLIIYDGKERPEVALDSDAEDLEDLSEESAD
ESAGAYAYKPIGTSSVDVRMIDFAHTTCRLYGEDSVVHEGQDAGYIFGLQSLIDIVTEIS
EESGE
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgagcccagccttcagggccatggacgtggagccccgcgacaagggcatcctgctggag
ccctttgtccaccaggtcggggggcactcctgcgtgctccgtttcaacgagacgaccctg
tgcaagcccctggtccccagggagcaccagttctacgagactctcccagctgagatgcgc
aaattcactccccagtacaaaggtgtggtatccgtgagcttcgaagaagacgaagacagg
aacttgtgtttaatagcacatccattaaaaggggaccacggaactgtggacagtgtagat
aattcagactgtgaaccaaaaagcaagctgctcaggtggacaaacaaaaagcatcacgtt
ctagaaacagacaagacctctaaggactgggtgcggcagcaccggaaagaggagaaggcg
aagagccataagttagaagaagaatttgagtggctgaagaaatctgaagttttgtactac
agtgtagagaaaaaggggaatgtaagttctcagcttaaacactacaacccttggagcatg
aagtgtcaccagcagcagttacagagaatgaaggagaatgcgaaacaccggaaccagtac
aaatttatcttgctggagaacctgacttcccgttacgaggtgccttgtgtcctggacctc
aaaatggggacacgccagcatggtgacgatgcttcagaggagaaggcagctaaccagatc
cgcaagtgccagcagagcacgtcggcagtcatcggtgtgcgtgtgtgcggcatgcaggtg
taccaggcgggcagtgggcagctcatgttcatgaacaagtaccacggacggaagctgtcc
gtacagggcttcaaggaggcacttttccagtttttccacaatggccggtacctgcgccgg
gagctcctgggcccggtgctcaggaagctgactgaactcaagggcgtgctggagcgacag
gaatcctaccgcttctactcaagctccctgctgatcatctatgacggcaaggagcggcct
gaagtggccctggactcggacgcggaggacttggaggacctgtcggaggagtctgctgac
gagtcggctggcgcctatgcctacaagcccatcggcaccagctcggtggacgtgcgcatg
attgatttcgcacacaccacatgcaggctgtatggtgaggacagtgtggtccacgaaggc
caggatgctggctatatctttgggctccagagcctgatagacattgtcacagagataagt
gaggagagcggggagtga

DBGET integrated database retrieval system