KEGG   Capra hircus (goat): 102187210Help
Entry
102187210         CDS       T02910                                 

Gene name
CPT1B
Definition
(RefSeq) carnitine palmitoyltransferase 1B
  KO
K19523  carnitine O-palmitoyltransferase 1, muscle isoform [EC:2.3.1.21]
Organism
chx  Capra hircus (goat)
Pathway
chx00071  Fatty acid degradation
chx01212  Fatty acid metabolism
chx03320  PPAR signaling pathway
chx04152  AMPK signaling pathway
chx04714  Thermogenesis
chx04920  Adipocytokine signaling pathway
chx04922  Glucagon signaling pathway
chx04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102187210 (CPT1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    102187210 (CPT1B)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    102187210 (CPT1B)
   04920 Adipocytokine signaling pathway
    102187210 (CPT1B)
   03320 PPAR signaling pathway
    102187210 (CPT1B)
  09159 Environmental adaptation
   04714 Thermogenesis
    102187210 (CPT1B)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102187210 (CPT1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:chx03029]
    102187210 (CPT1B)
Enzymes [BR:chx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     102187210 (CPT1B)
Mitochondrial biogenesis [BR:chx03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    102187210 (CPT1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N DUF3128
Motif
Other DBs
NCBI-GeneID: 102187210
NCBI-ProteinID: XP_017904483
Position
5
AA seq 771 aa AA seqDB search
MAEAHQAVAFQFTVTPEGVDFQLSREVLKQIYLSGVRSWKKRLIRIKNGILRGVYPGSPT
SWLVVVMTTVGSSCYNVDVSMGLVYYIQRWLPEGRPYRTPYTRXLLSMAVFSTGVWVMGI
FFFRQTLKLLLSYHGWMFEMHGQTSHLTRVWAVCVRLLSGRRPMLYSFQTSLPKLPVPSV
PATVHRYLESVEHLLDDEQYYRMEMLAKEFEEKTAPRLQKYLVLKSWWATNYVSDWWEEY
VYLRGRNPLMVNSNYYVMDLVLVKNTDVQAARLGNAVHAMITYRRKLDREEIKPVMALGL
VPMCSYQMERMFNTTRIPGKDTDMLQHLPDSRHVAVYHKGRFFKLWLYEGCRLLKPRDLE
MQFQRILDDPSPPQPGEERLAALTAGGRVEWAQARQAFFSSGKNKAALDAIERAAFFVAL
DEESHHYDPEDEASLSLYGKALLHGNCYNRWFDKSFTLISFKNGQLGLNTEHAWADAPII
GHLWEFVLGTDSFHLGYTETGHCLGKPNPVLPPPQRLQWDISEQCQAVIESSYQVAKALA
DDVELYCFQFLPFGKGLIKKCRTSPDAFVQIALQLAHFRDKGKFCLTYEASMTRMFREGR
TETVRSCTRESTAFVQAMVQGRHPNEDLRRLFRKAAEKHQNMYRLAMTGAGIDRHLFCLY
VVSKYLGVESPFLAEVLSEPWRLSTSQIAQFQIRMFDPNKYPKHLGAGGGFGPVADDGYG
VSYMIAGENTIFFHVSSKFSSSETNAQRFGNQIRQALLDIANLFQVSKADG
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagcgcaccaggctgtggccttccagttcactgtgaccccagagggggtcgac
ttccagctcagtcgggaggtgctgaaacagatctatctgtctggggtcaggtcctggaag
aaacgcctgattcgcatcaagaatggcatcctgaggggcgtgtaccctggcagccccacc
agctggctggttgtggttatgacaacagtgggttcctcctgctacaacgtggacgtttcc
atgggactggtctattatatccagagatggcttcctgagggacgtccctaccggacccca
tacacccggnacctcctcagcatggccgtcttctccacgggcgtctgggtgatgggcatc
ttcttctttcgccaaaccctgaaactgcttctttcctaccacggttggatgtttgagatg
cacggccagaccagccacttgaccagagtctgggctgtctgcgtccgccttctgtctggc
cgacggcccatgctctacagcttccagacgtctctgcccaagctgccggtgcccagcgtg
ccagccacagttcatcggtacctggaatccgtggaacacttgttggatgatgagcagtat
taccgaatggagatgctggccaaggagttcgaggagaagaccgcccccaggctgcagaag
tacctggtgctcaagtcctggtgggcaaccaactacgtgagcgactggtgggaggagtac
gtctacctgcggggcaggaaccccctcatggtcaacagcaactactacgtcatggacctc
gtgcttgtcaagaacacagacgtgcaggctgcccgcctgggaaatgctgtccacgccatg
atcacgtatcgccgtaaactggaccgtgaagagatcaagccggtgatggcactgggcctt
gtgcccatgtgctcctaccagatggagaggatgttcaacaccactcgcatcccggggaag
gacacagacatgctccagcacctcccggacagcaggcacgtggccgtctaccacaagggc
cgcttcttcaagctgtggctctacgagggctgccgcctgctcaagcctcgggacctggag
atgcagttccagagaatcctggacgacccctccccaccccagcccggggaggagaggctg
gcagccctcactgcagggggaagagtggagtgggcgcaggcacgccaggccttcttcagc
tctggcaagaacaaggctgccctggatgccatcgagcgcgctgcgttcttcgtggctctg
gacgaggagtctcaccactacgacccagaggacgaggccagcctcagcctctacggcaag
gccctgttgcacggcaactgctacaacaggtggttcgacaagtccttcacactcatctct
ttcaagaacggccagctgggactcaacacagagcacgcgtgggcagacgcccctatcata
gggcacctctgggagtttgtcctgggcaccgactccttccatctgggctacacagagacg
gggcactgtctgggcaaacccaaccctgtgctgcccccgcctcagcgactccagtgggac
atttctgagcagtgccaggctgtcatcgagagttcctaccaggtggccaaggctctggcg
gacgacgtggagctgtactgcttccagttcctgccctttggcaaaggcctcatcaagaag
tgccggaccagccctgacgccttcgtgcagatcgccctgcagctggcgcacttccgggac
aagggcaagttctgcctgacctacgaagcctcgatgactagaatgttccgcgagggccgg
acagagaccgtgcgctcctgcacccgtgagtccacagcatttgttcaggccatggtgcag
gggcgccacccgaacgaagacctccggcgtctgttccggaaggctgctgagaagcaccag
aacatgtaccgcctggccatgacaggggcgggcatcgacaggcacctcttctgcctttac
gtggtctccaagtacctgggagtcgagtcccctttcctggctgaggtgctctcagaaccc
tggcgcctctccactagccagatcgctcaattccagatccgtatgttcgacccaaacaag
taccccaaacacctgggtgctggcggtggctttggccctgtggcagatgatggctacggt
gtttcctacatgatcgcaggtgagaacaccatcttcttccacgtctccagcaagttctcc
agctcagagacgaatgcccagcgctttgggaaccagatccgccaagctctgctagacatc
gccaatcttttccaagtttccaaggctgatggctaa

DBGET integrated database retrieval system