KEGG   Capra hircus (goat): 102187288Help
Entry
102187288         CDS       T02910                                 

Gene name
MINPP1
Definition
(RefSeq) multiple inositol-polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
chx  Capra hircus (goat)
Pathway
chx00010  Glycolysis / Gluconeogenesis
chx00562  Inositol phosphate metabolism
chx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102187288 (MINPP1)
   00562 Inositol phosphate metabolism
    102187288 (MINPP1)
Enzymes [BR:chx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     102187288 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     102187288 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708
Motif
Other DBs
NCBI-GeneID: 102187288
NCBI-ProteinID: XP_017897119
UniProt: A0A452EEL3
Position
26
AA seq 486 aa AA seqDB search
MHRGPCSLVRVSATPVAALAVALLSSLSRCSLLEPENSVVSALSPYFGTKTRYEDVNPGL
LPDPEAPRRDPELLEETCTPVQLVALIRHGTRYPTTKQIRKLRQLHGLLQARGAEDDRTR
AAGRGDLGAALADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLQLV
TSSKHRCVDSGAAFLQGLWQHYHPGLPPPDVADMECGPPRINDKLMRFFDHCEKFLTQVE
RNATALYHVEAFKTGPEMQNILKKVADILQVPVNNLNADLIQVAFFTCSFDLAIKGVKSP
WCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFQHLDKAVKQKQCSQPV
SSPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKEQMHRKFRSGHIVPYASNLIFVLY
HCKNAKTPKEEFRVQLLLNEKVLPLAHSQETVSLYEDLKNHYKDILQSCHTSEECELPKV
NTSDEL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgcggcccgtgcagcctcgtcagggtctccgcaacgcccgtcgcggccctggct
gtggcgctgctctcgtcgctctctcgctgctccctcctggagccggagaacagtgtggtc
tccgcgctcagcccctacttcggcaccaagactcgctatgaggatgtcaaccccgggctc
ctgccggaccccgaagcgccgcggcgggacccggagttgttagaggaaacctgtaccccg
gtgcaactggtcgccctcatccgccatggcacccgctacccgacgaccaaacagatccgc
aagctgcggcagctgcacgggctgctgcaggcccgcggggccgaggatgaccggactcgc
gctgccggccgcggcgacctgggcgccgcgctggccgactggccgctatggtacgctgac
tggatggacgggcagctggtggagaaggggcggcaggacatgcgacagctggccctgcgc
ctggcctcccttttcccagccctcttcagcagagagaactacggccgcctgcagctagtc
accagctccaagcaccgctgcgtggacagcggcgccgccttcctgcaagggctctggcag
cactaccacccggggttaccgccacccgacgtcgcagatatggagtgtggacctccaaga
attaatgataaattaatgaggttctttgatcattgtgagaagtttttaactcaagtggaa
aggaatgctactgctctttatcatgtagaagccttcaaaactggaccagaaatgcagaac
attttaaaaaaagttgcagatattttgcaagtgccagtcaacaacttaaatgcagattta
attcaggtagcttttttcacctgttcctttgacctggcaattaaaggtgttaaatctcct
tggtgtgatgtttttgacatagatgatgcaaaggttttagaatatttaaatgatctgaaa
caatattggaaaagaggatatggatatactattaacagtcgatccagctgcaccctgttt
caggatatctttcagcacttggacaaagcagttaaacagaaacaatgttctcaaccagtt
tcctctccagtcatcctccagtttggccatgcagagacccttcttccactgctttctctc
atgggctacttcaaagacaaggaacccctaacagcttacaattacaaggagcaaatgcat
cggaagttccgaagtggtcacattgtaccctatgcttcaaacctgatatttgtgctttac
cattgtaaaaacgctaagactcctaaagaagagttccgagtgcagttgttactgaatgaa
aaagtgttaccattggctcactcacaagaaactgtttctttgtatgaagatctgaagaac
cactataaggacatccttcagagttgtcataccagtgaagaatgtgaactaccaaaggtg
aacacatctgatgagctatga

DBGET integrated database retrieval system