KEGG   Capra hircus (goat): 102187484Help
Entry
102187484         CDS       T02910                                 

Gene name
CAMK4
Definition
(RefSeq) calcium/calmodulin dependent protein kinase IV
  KO
K05869  calcium/calmodulin-dependent protein kinase IV [EC:2.7.11.17]
Organism
chx  Capra hircus (goat)
Pathway
chx04020  Calcium signaling pathway
chx04024  cAMP signaling pathway
chx04211  Longevity regulating pathway
chx04371  Apelin signaling pathway
chx04380  Osteoclast differentiation
chx04720  Long-term potentiation
chx04722  Neurotrophin signaling pathway
chx04725  Cholinergic synapse
chx04921  Oxytocin signaling pathway
chx04925  Aldosterone synthesis and secretion
chx05031  Amphetamine addiction
chx05034  Alcoholism
chx05214  Glioma
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102187484 (CAMK4)
   04020 Calcium signaling pathway
    102187484 (CAMK4)
   04024 cAMP signaling pathway
    102187484 (CAMK4)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102187484 (CAMK4)
   04925 Aldosterone synthesis and secretion
    102187484 (CAMK4)
  09156 Nervous system
   04725 Cholinergic synapse
    102187484 (CAMK4)
   04720 Long-term potentiation
    102187484 (CAMK4)
   04722 Neurotrophin signaling pathway
    102187484 (CAMK4)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102187484 (CAMK4)
  09149 Aging
   04211 Longevity regulating pathway
    102187484 (CAMK4)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    102187484 (CAMK4)
  09165 Substance dependence
   05031 Amphetamine addiction
    102187484 (CAMK4)
   05034 Alcoholism
    102187484 (CAMK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    102187484 (CAMK4)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     102187484 (CAMK4)
Protein kinases [BR:chx01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   102187484 (CAMK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like FTA2 Kdo APH Pkinase_fungal YrbL-PhoP_reg
Motif
Other DBs
NCBI-GeneID: 102187484
NCBI-ProteinID: XP_017905469
UniProt: A0A452EA99
Position
7
AA seq 464 aa AA seqDB search
MLKVTTPSCSASSCSSVTATVAPGPGSLVPDYWVDGSNRDALGDFFEVESELGRGATSIV
YRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLEL
VTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAP
LKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEP
FYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKLIVLDPKKRLTTFQALQHPWV
TGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSSHSGVQEGRASREPSP
PQAGDGGVSGDEGAPGAAEGAAGVELPEVQVGEEEGSADGDAAAPRVEPQASEEEMEEAG
PETEGRLAWETQGPTGAAAAAEGREEDPAPEVGAQQGAAVPPED
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaagtcacgacgccctcgtgctccgcctcgtcctgctcctcggtcaccgccacc
gtggccccgggacccgggagcctggtgccggattactgggtcgacggctccaacagggat
gctctgggcgatttcttcgaggtggagtcggagctgggacggggtgctacatccattgtg
tacagatgcaaacagaaggggacccagaagccttatgctctcaaagtgttaaagaaaaca
gtggacaaaaaaatcgtaagaactgagataggagttcttcttcgcctctcacatccaaac
attataaaacttaaagagatatttgaaacccctacagaaatcagtctggtcttagaactc
gtcacaggaggagagctgtttgacaggattgtggaaaagggatattacagtgaacgagat
gctgcagatgccgtcaaacagatcttggaggcagttgcttacctacatgaaaatgggatt
gtccatcgtgatctcaaaccagagaatcttctctatgcaactccagcaccagatgcgcca
ctcaaaattgctgactttggactctccaaaatcgtagaacatcaagtactcatgaagaca
gtatgcggaaccccagggtactgcgcacctgaaatccttagaggctgcgcctatggaccc
gaggtggacatgtggtctgtggggataatcacctacatcttactttgtggatttgaacca
ttctatgatgagagaggcgatcaattcatgttcaggagaattctgaattgtgaatattac
tttatctccccctggtgggatgaagtatctctgaatgccaaggatttggtcagaaaatta
attgtgttggatcctaagaaaaggctgactacctttcaagctctccagcacccgtgggtc
acaggtaaagctgccaattttgtacacatggatacggctcaaaagaagcttcaagaattc
aatgcccggcgcaagctcaaggcggcggtcaaggccgtggtggcctcctccaggctcggc
agcgccagcagcagccacagcggcgtccaggagggccgggccagccgggagccgtctcca
cctcaggctggcgatgggggcgtctcaggggacgagggggccccgggggcagccgagggg
gccgccggagtggagctgccagaggtgcaggtgggggaggaggaaggcagtgctgatgga
gacgccgcggcccccagggtggagccccaggcatcagaggaggagatggaggaggccggc
ccggagacggaggggcgcctggcgtgggagacgcaggggcccactggagccgcggcagcc
gcggagggacgggaggaggaccctgccccggaggtcggagctcagcagggtgccgcggtc
ccgcccgaggactag

DBGET integrated database retrieval system