KEGG   Capra hircus (goat): 102187595Help
Entry
102187595         CDS       T02910                                 

Gene name
PLA2G4E
Definition
(RefSeq) phospholipase A2 group IVE
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
chx  Capra hircus (goat)
Pathway
chx00564  Glycerophospholipid metabolism
chx00565  Ether lipid metabolism
chx00590  Arachidonic acid metabolism
chx00591  Linoleic acid metabolism
chx00592  alpha-Linolenic acid metabolism
chx01100  Metabolic pathways
chx04010  MAPK signaling pathway
chx04014  Ras signaling pathway
chx04072  Phospholipase D signaling pathway
chx04217  Necroptosis
chx04270  Vascular smooth muscle contraction
chx04370  VEGF signaling pathway
chx04611  Platelet activation
chx04664  Fc epsilon RI signaling pathway
chx04666  Fc gamma R-mediated phagocytosis
chx04724  Glutamatergic synapse
chx04726  Serotonergic synapse
chx04730  Long-term depression
chx04750  Inflammatory mediator regulation of TRP channels
chx04912  GnRH signaling pathway
chx04913  Ovarian steroidogenesis
chx04921  Oxytocin signaling pathway
chx05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102187595 (PLA2G4E)
   00565 Ether lipid metabolism
    102187595 (PLA2G4E)
   00590 Arachidonic acid metabolism
    102187595 (PLA2G4E)
   00591 Linoleic acid metabolism
    102187595 (PLA2G4E)
   00592 alpha-Linolenic acid metabolism
    102187595 (PLA2G4E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102187595 (PLA2G4E)
   04010 MAPK signaling pathway
    102187595 (PLA2G4E)
   04370 VEGF signaling pathway
    102187595 (PLA2G4E)
   04072 Phospholipase D signaling pathway
    102187595 (PLA2G4E)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102187595 (PLA2G4E)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102187595 (PLA2G4E)
   04664 Fc epsilon RI signaling pathway
    102187595 (PLA2G4E)
   04666 Fc gamma R-mediated phagocytosis
    102187595 (PLA2G4E)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102187595 (PLA2G4E)
   04913 Ovarian steroidogenesis
    102187595 (PLA2G4E)
   04921 Oxytocin signaling pathway
    102187595 (PLA2G4E)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102187595 (PLA2G4E)
  09156 Nervous system
   04724 Glutamatergic synapse
    102187595 (PLA2G4E)
   04726 Serotonergic synapse
    102187595 (PLA2G4E)
   04730 Long-term depression
    102187595 (PLA2G4E)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102187595 (PLA2G4E)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    102187595 (PLA2G4E)
Enzymes [BR:chx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     102187595 (PLA2G4E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2 CEP76-C2
Motif
Other DBs
NCBI-GeneID: 102187595
NCBI-ProteinID: XP_017909892
Position
10
AA seq 831 aa AA seqDB search
MLQKQMPVWVSHYPPDSCQEDGDRPAATCALEEGLSPCHLLTVRVIRMKNVRQADVVSLT
DCFVSLWLPTASQKRLRTRTISNCRNPEWNETFSFQIQSQVKNVLELSVCDEDTVTPDDH
LLTVLYDLTKLCFRKKTHVKFPLNTEGMEELEVEFLLEESPSPPENLITNGVLVSRQMSC
LEVCAESRRPKKRKKKDLLVTVTESFEHTQRVSPCLESCCSNPACFQYPKYFQPEVHVEL
PKSPWICELCCCAGQKGPVCQSLHCLPDGQAVTLPVNENCELHMKSTPCSQALDVRLGFS
LCQAELEFLQKRRVVVAQALKEVLQLEEDLRADEVPLIAIMATGGGTRSMTAMYGHLLAL
QKLNILNCASYITGLSGATWTMATLYRDPDWSSKSLERAILEARRHVVKDKMPALFPDQL
LKFQEELQQRRQEGYKVTFTDFWGLLIEACLGDERNECKLSDQRAALCQGQNPLPIYLTI
NVKDDVSNQDFREWFEFSPYEVGMQKYGAFIPTELFGSEFFMGRLRKRIPESRMCYMLGL
WSSIFSLNLLDAWNLSHTSEEFFHQWTRDRVHDIEDEPLLPEIPKCDANVLDTTVVTPAS
WLSNTFRDILTHRAFVSKFHNFLLGLQLHTDYLQNSQFSMWKDTVLDSFPNQLTGSVKHL
CLLDTAFFVNSSYAPLLRPERKADLIIHLNYCAGSQTKPMKQTCEYCAVQNIPFLKYELQ
KEEDNLKECYLLENAQEPDTPIVTFFPLICDTFQNYKAPGVERSPEELEQGQVDIYGPKT
PYATKELTYTEAAFDKLVKLSEYNILNNKDKLLQALRLAVERKRQKSPCPL
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
atgctccagaagcagatgcctgtgtgggtctcccactacccgccagactcatgccaagag
gatggggacaggcccgcggccacctgtgcattggaggaggggctgtctccatgccacctg
ctgacagtgagggtcatccgcatgaagaacgtccgacaggctgacgtggtgagcctgaca
gactgctttgtgagcctttggctgcccaccgccagtcaaaagaggctgaggactaggacc
atctccaactgccgaaacccagaatggaatgaaaccttcagcttccagatccagagccaa
gtgaagaacgttctggagctgagcgtctgtgatgaagacacagtgacaccagatgaccat
ctcttgacagttctctatgacctcaccaagctctgcttccgaaagaaaacccacgtgaag
ttcccgctcaacacagagggcatggaggagctggaagtggagttcctgctggaggagagc
ccctctccacctgagaacctcatcacgaacggcgtgctggtgtctcgacaaatgtcctgc
ctggaggtttgtgcagaatccaggaggccaaagaagaggaaaaagaaggacctcctggtg
acagtgacggagtccttcgagcacacccagcgtgtctcaccctgcctggagtcctgctgc
tcaaaccctgcctgcttccaataccccaaatacttccagcccgaggtgcacgtggagttg
cccaagagcccgtggatctgtgagctttgctgctgtgcgggccagaagggccctgtgtgc
cagtccctccattgcctccccgacggccaggcggtgaccttgcctgtgaatgagaactgt
gaattacacatgaagtctacaccctgttcccaggcgttggacgtgcggctgggcttcagc
ctgtgccaggcagaactggagttcctgcagaaacggagggtggtggtggcccaggcgctg
aaggaggtgctgcagctggaggaggacctgcgggcagatgaggtcccgctgatagccatc
atggccactggaggtggaacaagatctatgaccgccatgtatggccacctgctggcactg
cagaagctgaacatcctgaactgtgccagctatatcaccggcctgtctggggccacctgg
accatggccaccttgtaccgtgaccctgactggtcctccaaaagcctggagcgcgccatc
ctcgaggcacggaggcacgtggtcaaggacaagatgcctgccctgtttccagaccagctc
ctcaaattccaggaggagctccagcagcgcaggcaggaaggctacaaggtcaccttcaca
gacttctggggcctgctgattgaggcctgtctgggggatgagagaaatgaatgcaaactg
tcagatcagcgtgctgctttgtgccagggccagaaccccctgcccatctacctcaccatc
aatgtcaaggatgatgtaagcaaccaggatttcagagagtggttcgagttctccccctac
gaggtgggcatgcagaagtatggagccttcatccccacagagctcttcggctccgagttc
ttcatggggcggctgaggaagagaatcccagagtcgcggatgtgctacatgctaggtttg
tggagtagcatcttctccctgaacctgcttgacgcctggaacctatcccacacctcggag
gagtttttccaccagtggacaagggatagagtgcatgatattgaagacgagccactcctg
cctgaaatccccaaatgtgatgccaacgtcctggacaccacagtggtgacgccagcatcc
tggctgtccaacactttccgcgacatcctcacccacagggcctttgtctccaagttccac
aatttcctgctggggctgcagctgcacactgactacctccagaacagccagttctccatg
tggaaagacacggtgctggacagcttcccaaaccagctgacaggatctgtgaaacacttg
tgcctgttggacaccgcattctttgtcaactccagctacgcacccctcctcaggcctgag
agaaaagctgacctcatcatccaccttaattactgtgctgggtcccagacaaagcccatg
aagcaaacctgcgagtactgcgccgtgcagaacatccccttcctcaaatacgagctgcaa
aaggaggaggataacctcaaggagtgctacctgctggagaacgcccaggagcccgacacc
cccatcgtgacctttttcccactcatctgcgacactttccaaaattacaaggccccaggt
gtggaacgaagccccgaggagctggagcagggccaggttgacatctacggtcccaaaact
ccctatgccaccaaggagctgacatacactgaggccgccttcgacaagctggtgaagctt
tccgagtataacatcctgaataacaaggacaagctccttcaggccttgcgactggcggta
gagaggaaacgccagaagagcccgtgtcccctctaa

DBGET integrated database retrieval system