KEGG   Capra hircus (goat): 102187897Help
Entry
102187897         CDS       T02910                                 

Gene name
SI
Definition
(RefSeq) sucrase-isomaltase
  KO
K01203  sucrase-isomaltase [EC:3.2.1.48 3.2.1.10]
Organism
chx  Capra hircus (goat)
Pathway
chx00052  Galactose metabolism
chx00500  Starch and sucrose metabolism
chx01100  Metabolic pathways
chx04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102187897 (SI)
   00500 Starch and sucrose metabolism
    102187897 (SI)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102187897 (SI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chx04147]
    102187897 (SI)
Enzymes [BR:chx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.10  oligo-1,6-glucosidase
     102187897 (SI)
    3.2.1.48  sucrose alpha-glucosidase
     102187897 (SI)
Exosome [BR:chx04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   102187897 (SI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 102187897
NCBI-ProteinID: XP_017909271
UniProt: A0A452E3J4
Position
1
AA seq 1813 aa AA seqDB search
MAKKKFSELEITLIVLFAIVTIIAIALVVVLATKTPAVEEISDSTRGTCPSVLNDPINQR
INCIPERSPTQTLCAARGCCWRPWNDSVIPWCFFVNNHGYNAEKVTSTNAGLEAKLKRKA
SPTLFGNDINSVLLTTQNQTRNRVRFKITDPNNRRYEVPHQFVKEFSGTAASDPLYNLEV
IHDPFSIKISRKSNNKILFDTSIGPLVYSDQYLQISARLPNEYIYGLGEHIHKRFRHDLY
WKTWPIFTRDQLPGDNNNNLYGHQTFFMCIEDTSGKSFGVFLMNSNAMEIFIQPTPIVTY
RVIGGILDFYIFLGDTPEQVVQQYQELIGRPAMPAYWNLGFQLSRWNYKTLDVVKEVVKR
NREAGIPFDTQITDIDYMEDKKIFTYDQVAFNGLPEFVQDLHAHGQKYVIILDPAVSIDK
RVNGTAYESYDRGTAQKVWVNESDGTTAIIGEVWPGLTVYPDFTNPSCIEWWANECYLFH
QQVNYDGLWIDMNEVSSFVQGSKKGCSANNLNYPPFTPDILDKLMYSKTICMDAMQYWGK
QYDVHSLYGYSMSIATEKAIEKVLPNKRSFILTRSTFAGSGSHSAHWLGDNTASWEQMEW
SITGMLEFGLFGIPLVGADICGFVAETTEELCRRWMQLGAFYPYARNHNADGYQHQDPAF
FGQDSPLVKSSKHYLNIRYALLPFLYTLFYKAHMFGETVARPFLHEFYEDTNSWIEDTQF
LWGPSLLITPVLKQGAEIVSAYIPDATWYDFETGVKRPWRKQRVDMQLPGDKIGLHLRGG
YIIPFQEPAVTTTASRKNPLGLIVALNDNNTAKGDFFWDDGETKDTIQKGNYILYTFSVS
NNKLDIICMHSSYPEGTALAFETVKVLGLIDTVTEVSVIEDNQPLRAHYNFSYDASNQIL
LIYNLTFNLGGNFTVQWDQTFLEVEKFTCYPNSDTATKERCEERGCLWQTAQLGSKAPEC
YFPKEDNSYLVHSTQYSSVGITADLQLNTANTRIKLPSDSISSLRVEVKYHKDDMLQFKI
YDAQNKRYEVPVPLNIPTTPTSTYETRLYDVEIKENPFGIQIRRRSTRRVIWDSRLPGFA
FNNQFIQISTRLPSEYVYGFGEMEHTTFRRDLNWHTWGMFTRDQPPGYKLNSYGFHPYYM
ALEDENNAHGVLLLNSNAMDVTFQPMPALTYRMIGGILDFYMFLGPSPEVVTKQYHEVIG
QPVMPPYWALGFQLCRYGYRNTSQVEEVYNDMVAARIPYDVHYTDIDYMERQLDFTIDDE
FRDLPQFVDKIRSEGMRYIIILDPAISGNETKPYPAFERGQEKDVFVKWPNTNDICWAKV
WPDLPNVTIDESLIEDEAVNASRAHAAFPDFFRNSTAEWWAKEIIDFYNNQMKFDGLWID
MNEPSSFVNGTTTNQCRNTELNYPPYFPELTKRTDGLHFRTMCMETEQILSDGSSVLHYD
VHNLYGWSQLKPTYDALQKATGKRGIIISRSTYPSAGRWSGHWFGDNYATWDNLEKSIIG
MMEFSLFGMSYTGADICGFFNNSEYQLCARWMQLGAFYPYARNHNSAFTRRQDPASWNKT
FSTMSRDILNIRYTLLPYFYTQMHEIHAHGGTVIRPLLHEFLNEKPTWDIFKQFLWGPAF
MVTPVLEPYVDTVEGYVPNARWFDYHTGKDIGVRETFHTFAAPLYEINLHVRGGYILPCQ
EPANNTFYSRQNYMKLIVAADDNQMARGSLFWDDGETIDTYERDLYSLVQFNLNKTILTS
TILKNGYINRSEMRLGYIHIWGKEKMRVSEVTLTHNGNKESVNFTEDQNLEILNIDLTGN
NVTLDEPIEVNWS
NT seq 5442 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaagaaattttctgaattagaaattactctgattgtcctctttgctatagtt
acaataatagctattgcccttgttgttgttttagcaactaagacacctgctgttgaagaa
atcagtgattcaacccgaggcacatgcccaagtgtgttgaacgatcctatcaaccagaga
ataaactgcattccagaacgatctcccacacagacactttgtgcagctcgaggttgctgc
tggaggccatggaatgattctgttattccttggtgcttcttcgtaaataaccacggctat
aatgctgagaaagtaacatcaacaaatgctggacttgaagccaaattaaaaaggaaagct
tcacctacactctttggaaatgacattaacagcgtactcctcacaactcaaaatcagaca
cgcaatcgtgtgcggttcaagatcactgatccaaataatagaagatatgaagttcctcat
cagtttgtaaaagaatttagtggaactgcagcttctgatccactatataatcttgaggtt
atacatgatccatttagcattaaaatttctagaaaaagcaataataaaattttgtttgat
accagcattggtcccctggtatactctgaccagtatttacagatctcagccagacttccc
aatgaatacatttatggtctcggggaacatattcataagagatttcgtcatgatttatat
tggaaaacatggccaatttttactcgggatcaacttcctggtgataataataataattta
tatggccatcaaacattcttcatgtgcattgaggatacttctggaaagtcatttggtgtt
ttcttaatgaacagcaatgcaatggagattttcatccaacctactccaatagtaacttac
cgagttataggtggaattctggacttttatatctttctgggagacacaccagaacaagta
gttcaacagtatcaggagctcattggacgaccagcaatgccagcttattggaatcttgga
ttccagctgagtcgctggaattacaagacacttgatgtagtgaaagaagtggtaaaaaga
aatcgggaagctggcataccatttgacacacaaatcactgatattgactatatggaagac
aagaaaatctttacttatgatcaagttgcatttaacggcctcccagaatttgttcaagat
ttgcatgcccacgggcagaaatatgtcatcatcttggaccctgcagtttccatagacaaa
cgtgtgaatgggacagcatatgagtcctatgataggggaactgcccaaaaggtgtgggta
aatgaatcagatgggactacagcaattattggagaggtatggccaggattaacagtatac
cctgatttcacaaatccaagttgcatagaatggtgggcaaatgaatgctacctttttcat
caacaagtaaattatgatggactttggattgacatgaatgaagtttccagctttgttcaa
ggttcaaagaaaggatgcagtgcgaacaacctgaattacccaccttttactcctgatatt
cttgacaaactcatgtattccaaaacaatttgcatggatgccatgcaatactggggaaaa
cagtatgatgtacacagcctctatggatatagtatgtctatagccacagagaaagctata
gaaaaagttcttcctaataaaagaagctttattctcacccgatcgacttttgctggatct
ggaagccattctgcacattggttaggagacaatactgcttcttgggaacaaatggaatgg
tctattacaggaatgctggagtttggtttgtttggaatacctttggttggagcagatata
tgtgggtttgtggctgagaccacagaagagctttgcagaaggtggatgcaacttggtgct
ttttatccatatgccagaaaccataacgctgatggatatcagcatcaggatccagcattt
tttggacaggattctcctttggttaagtcatcaaaacactatttgaatattcgctatgcc
ttgttacctttcctttatactctattttataaagcccatatgtttggagaaacagtagca
aggccttttcttcatgagttttatgaggatactaatagctggattgaggatactcagttc
ttatggggcccctcattacttataacccctgtattgaaacagggtgcagaaatagtgagt
gcatacatccctgatgctacttggtatgactttgaaactggtgtaaaaaggccatggaga
aaacaacgtgttgatatgcagcttccaggagacaaaataggattacatcttagaggtggt
tacattatcccctttcaagaacctgctgtaactacaacagcaagccgaaagaaccctcta
ggacttatagttgcattaaatgataataacacagcaaaaggagactttttctgggatgat
ggagaaactaaagataccatccaaaagggaaactacattttatatacattttcagtttct
aataacaagctagatatcatatgtatgcattcatcgtacccagagggaactgctttagca
tttgagactgtaaaagtccttgggttgatagacactgttacagaagtttcagtgatagaa
gacaatcaaccactgagagctcactacaatttcagttatgatgcttccaaccagattcta
ctaatttacaatctgacatttaaccttggaggaaactttactgttcaatgggatcaaact
ttcttggaagttgaaaagtttacttgttatccaaattcagacacggcaactaaagaacgc
tgtgaagaacgtggctgcttatggcaaacggctcagttaggatccaaagcacctgagtgt
tactttcctaaagaagacaactcttatttagtccactcaactcagtactcatcagtgggt
ataacagctgacctccagctgaatactgcaaatactcgaataaagctaccttctgattcc
atctcatctcttcgtgtggaggtgaaatatcacaaagatgatatgttgcagtttaagatt
tatgatgcccaaaataagagatatgaagttccagtaccattgaacattccaactacacca
acaagtacttatgaaactagactttatgatgttgaaatcaaggaaaatccttttggcatt
cagattcgaagaagaagcacaagaagagttatttgggattctcgccttcctggttttgct
tttaacaaccagttcattcagatatctacacgcctgccttcagaatatgtgtatggtttt
ggggaaatggaacacacaacatttaggcgtgacctgaactggcatacttggggaatgttc
accagagaccaaccccctggttacaaacttaattcctatggatttcatccctattacatg
gctctggaagatgagaacaatgctcatggagttctcttacttaacagcaatgcaatggat
gttacatttcagccaatgcctgctctgacatatcgcatgattggaggaatcttggacttt
tatatgtttttgggcccatctccagaagtcgtaacaaagcaataccatgaagtaattggc
caaccagtcatgccaccttactgggctttgggattccagttatgtcgttatgggtacaga
aatacttcacaagttgaagaagtatataatgacatggtggctgctcggatcccctatgat
gttcattacacagatattgattacatggaaaggcaattagactttacaattgatgatgaa
ttccgtgaccttcctcagtttgttgacaaaataagaagtgagggaatgagatacattatt
atcctggatccagcaatttcaggaaatgaaacgaagccttaccctgcctttgaaagagga
caggagaaagatgtctttgtcaaatggcctaacacaaatgatatttgttgggcaaaggtt
tggccagatttgcctaatgtgacaatagatgaaagtttaattgaagatgaagctgttaat
gcttccagagctcatgcagcttttccagatttcttcaggaattctacagcagagtggtgg
gcaaaggaaattatagatttttataataaccagatgaagtttgatggattgtggattgat
atgaatgaaccatcaagttttgtaaatggaacaactactaatcaatgcagaaatacagag
ctaaattatccaccttatttcccagaactcacaaaaagaactgatggattacatttcaga
accatgtgtatggaaacagagcagattcttagtgatggatcatctgttttgcattatgat
gttcacaatctatatggatggtcacagctgaaacctacttatgatgcattgcaaaaggca
actggcaaaagaggaattattatttctcgttccacatatccttctgctggacgatggtca
ggacactggtttggagacaactatgcaacatgggacaatttggaaaaatctatcattggt
atgatggaatttagtctctttggaatgtcatatactggagcagatatctgtggtttcttc
aacaattcagaatatcagctctgtgcccgctggatgcaacttggagcattttatccatat
gcaagaaatcacaacagtgcatttactagaagacaagatcctgcttcctggaataaaact
ttttctacaatgtcaagggacattctaaatattagatacactttattgccctacttctat
acacagatgcatgaaattcatgctcatggtggcactgttatccgaccccttttgcatgag
tttttaaatgaaaagccaacctgggatatattcaaacagtttctgtggggtccagcattt
atggttacccctgtattggaaccttacgttgacactgtagaaggctatgtccctaatgct
cggtggtttgattaccatacaggcaaagatattggtgtcagagaaacatttcatacgttt
gcagctcctttatatgaaatcaacctacatgtccgtggtggttacatcctaccatgtcaa
gagcctgctaacaacacattttacagccggcagaattacatgaagctcattgttgctgca
gatgataatcagatggcacgaggatctctgttttgggatgatggagagactattgacacc
tatgaaagagacctatattccttggtgcaatttaatttaaataagaccatcttgacaagc
actatactgaaaaatggttacataaacagaagtgaaatgaggcttggatatatccacata
tgggggaaagaaaagatgcgtgttagtgaggttactctcacacataacggaaataaagag
tctgttaactttactgaagaccaaaacctggagatattaaatattgatctaacagggaat
aatgttactctagatgaaccaatagaagtcaactggtcatga

DBGET integrated database retrieval system