KEGG   Capra hircus (goat): 102188052Help
Entry
102188052         CDS       T02910                                 

Gene name
GALC
Definition
(RefSeq) galactosylceramidase
  KO
K01202  galactosylceramidase [EC:3.2.1.46]
Organism
chx  Capra hircus (goat)
Pathway
chx00600  Sphingolipid metabolism
chx01100  Metabolic pathways
chx04142  Lysosome
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    102188052 (GALC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    102188052 (GALC)
Enzymes [BR:chx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     102188052 (GALC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_59 Glyco_hydro_59M Glyco_hydro_30
Motif
Other DBs
NCBI-GeneID: 102188052
NCBI-ProteinID: XP_017909377
UniProt: A0A452F6F4
Position
10
AA seq 690 aa AA seqDB search
MTCHTMAERLIQASRQRRAKAMTAAAGLAGQAAVPLLLCALLAPSGAYVLDDSEGLGREF
DGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHVLKVEIGGDGQTTDGTEPS
HMHYALDENYFRGYEWWLMKEAKKRNPNITLIGLPWSFPGWLGKGFNWPYVNLQLTAYYI
VTWIVGCKHYHDLDIDYIGIWNERAFDVNYIKVLRRMLNHQGLQHVKIIASDNLWEPISA
SMLLDPELLKVIDVIGAHYPGTLTVKDARLTKKKLWSSEDFSTVNSDMGAGCWGRILNQN
YVNGYMTSTIAWNLVASYYQQLPYGRCGLMTAQEPWSGHYVVEAPVWVSAHTTQFTQPGW
YYLKTVGHLERGGSYVALTDGLGNLTVIVETMSHKHSRCIRPLLPYFNVSHQFATFDLKG
SFSQIPELQVWYTKLGKPSERFLFKQLDSLWLLDSGGSFTLELQEDELFTLTTLTSGRKG
SFPPPPKPQRFPSVYEDNFNIDYPFFSEAPNFADQTGVFEYYVNMEDPGDHRFTLRQVLN
QRPITWAADAFNTISVIGDYTWSNLTIKCDVYIETPEKGGVFIAGRVNKGGILIRSARGI
FFWIFANGTYRVTGDLAGWIIYSLGHADVTAKKWYTLTLTLNGRFSSGKLNGKTLWKNIS
VNFPENGWAAIGTHSFEFAQFDNFRVEASH
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgacctgtcacacaatggctgagcgcctaattcaggcctcccggcaacgccgggcgaaa
gccatgacagccgccgcgggtttggcgggccaagccgcggtgcccctgctgctgtgcgcg
ctgctggcacccagcggcgcgtacgtgctcgacgactccgaggggctgggccgggagttc
gacggcatcggagcggtcagcggcggcggggcaacctcccgacttctagtaaattaccca
gagccctaccgttctgaaatactggattatctctttaagccaaacttcggtgcctcattg
catgttctaaaagttgaaataggtggtgatgggcagacaacagatggcacagagccctcc
cacatgcactacgcattagatgagaattatttccgaggatatgaatggtggttgatgaag
gaagctaagaagcggaaccctaatatcacactcatagggctgccatggtcgttccctgga
tggttggggaagggcttcaactggccttacgtcaatcttcagctgaccgcctactacatc
gtgacctggattgtggggtgcaagcattatcacgacctggacattgattacatcggaatt
tggaatgagagggcatttgacgttaattatatcaaggtgttaagaaggatgctgaaccat
caaggtctccagcacgtgaaaatcatagcgagtgataatctctgggagcccatttctgct
tctatgctgcttgaccctgagctcttgaaggtgattgatgtaataggagctcattaccct
gggacgcttacagtaaaggatgctaggttgactaagaagaagctttggtcttctgaagat
tttagcactgtaaatagtgatatgggtgcaggctgctggggccgcatattgaatcagaat
tacgtcaatggctacatgacttccaccatcgcttggaacttggtggctagttactatcaa
cagttgccgtacgggcgttgtggactgatgactgctcaggagccatggagtggacactac
gtggtagaagctcctgtctgggtatcagctcataccactcagtttactcaaccaggttgg
tattacctgaagacagttggccatttagagagaggaggaagctatgtagctctgacggat
ggcttaggtaacctcactgtcatcgttgaaactatgagtcataaacattcccggtgtata
cgaccacttcttccctatttcaatgtatcacatcagtttgctacgttcgatcttaagggt
tcttttagccaaatacccgagctgcaggtgtggtataccaaacttggaaaaccatcggag
agatttctcttcaaacaactggattctctatggctgctcgatagcggtggcagcttcacg
ctggaactgcaggaggacgagctgttcacgctcaccacgctcacctccggccgcaaaggc
agcttcccaccacctcccaagccccagcgcttcccctctgtctatgaggataacttcaac
attgattacccgttttttagtgaagctccaaattttgctgaccagaccggggtgtttgaa
tactacgtgaatatggaagaccccggagaccatcgcttcacactgcggcaggtcctcaat
cagaggcccatcacgtgggctgccgatgcgttcaacaccatcagcgttatcggggattac
acatggtccaatctgactataaagtgtgatgtgtacatagagacccctgagaagggaggc
gtgttcattgctggaagagtcaataaaggtggtattttgattagaagcgccagggggatt
ttcttctggatttttgcaaatggaacctacagagtcacaggcgatctagctggatggatc
atatatagtttaggacatgctgatgttacagcaaaaaaatggtatacactcactttaact
ctgaatggtcgtttctcctccggcaagctgaatggcaagaccctctggaagaacatctct
gtgaacttcccagaaaacggctgggccgcgattgggactcactcctttgaatttgcgcag
tttgacaacttccgtgtggaagcttcgcactaa

DBGET integrated database retrieval system